Highly Trusted
Why We Scored It 81/100
AI Website Analysis
burton.co.uk looks like a legit website. There are some bad reviews - as this appears to be a online shop you may wish to read about those to ensure they won't affect you as they could be related to customer service. Feel free to add your own review or comment below if you disagree, it's great to hear everybody's opinion and helps others.
burton.co.uk Preview
Men's Fashion | Men's Clothing & Accessories | Burton
Discover Fashion, Grooming & Homeware collections at Burton & so much more, get everything you need with free delivery.
Website Reputation
Domain Age
28 Years, 360 Days
Website Likely From
United States
Bad Reviews Detected
See reviews below →
Highly Trusted
Security Analysis
SSL Certificate
All Good
Expired 13 days ago
Firewall Protection
Fastly Hosted
External Scans
Clean
Related to other Risky Websites
No
100% security standards met
Reviews & Ratings

Trustpilot (1,122 reviews)
2 months ago

SiteJabber (6 reviews)
2 months ago

WebofTrust (3 reviews)
2 months ago

ReviewsIO
1 year ago
AI-Powered Insights
Overall Text Sentiment Analysis
Based on written review content
FAQs
Common questions about burton.co.uk website security analysis
Is burton.co.uk safe to use?
Based on our comprehensive analysis, burton.co.uk appears to be safe. Our security assessment gave it a trust score of 81/100.
Key factors analyzed:
- • SSL certificate validation and security
- • Domain age and registration details
- • Hosting location and infrastructure
- • Community reviews and reputation data
- • Blacklist checking across security databases
What do the trust scores mean?
Our trust scores range from 0-100 and indicate the overall safety and legitimacy of a website:
How accurate is this security analysis?
Our analysis combines multiple authoritative data sources and uses advanced algorithms to provide highly accurate assessments. However, no automated system is 100% perfect.
We recommend:
- • Using our analysis as one factor in your decision
- • Checking multiple review sources for important transactions
- • Trusting your instincts if something feels wrong
- • Being extra cautious with financial or personal information
What should I do if I encounter a scam website?
If you've encountered a scam website, take these immediate steps:
Immediate Actions:
- • Do not provide any personal or financial information
- • Close the website immediately
- • Run antivirus scan if you downloaded anything
- • Change passwords if you entered any credentials
Report the Scam:
- • Report to FTC at reportfraud.ftc.gov
- • Report to your local authorities
- • Submit a review on our platform to warn others
- • Share warnings with friends and family
Why does burton.co.uk have this trust rating?
The trust rating for burton.co.uk is based on multiple security and reputation factors:
Positive Factors:
- • Positive community feedback
- • No security warnings detected
Risk Factors:
- • No significant risks detected
Highly Trusted
AI Website Analysis
burton.co.uk looks like a legit website. There are some bad reviews - as this appears to be a online shop you may wish to read about those to ensure they won't affect you as they could be related to customer service. Feel free to add your own review or comment below if you disagree, it's great to hear everybody's opinion and helps others.
burton.co.uk Preview
Men's Fashion | Men's Clothing & Accessories | Burton
Discover Fashion, Grooming & Homeware collections at Burton & so much more, get everything you need with free delivery.
Dashboard Controls:
Site Information
Key Statistics
{ "domain": null, "title": "Men's Fashion | Men's Clothing & Accessories | Burton", "description": "Discover Fashion, Grooming & Homeware collections at Burton & so much more, get everything you need with free delivery.", "age": "28 Years, 360 Days", "value": "$65.2K", "country": "United States", "coordinates": "47.4815, -122.246", "lastChecked": "2025-07-26T12:11:00.000000Z", "categories": null }
Risk Indicators
SSL & Certificates
{ "securityInfo": { "hideSection": false, "sslValid": { "type": "success", "text": "All Good", "origBValue": true, "origSValue": "All Good", "origNValue": null }, "sslName": "\/CN=burton.co.uk", "sslValidFrom": { "type": "primary", "text": "2025-06-27", "origSValue": "2025-06-27", "origBValue": null, "origNValue": null }, "sslValidFromDaysAgo": { "type": "success", "text": "103 days ago", "origNValue": -103, "origSValue": "103 days ago", "origBValue": null }, "sslValidTo": { "type": "danger", "text": "2025-09-25", "origSValue": "2025-09-25", "origBValue": null, "origNValue": null }, "sslValidToDaysLeft": { "type": "danger", "text": "Expired 13 days ago", "origNValue": -13, "origSValue": "Expired 13 days ago", "origBValue": null }, "redirectsToHTTPS": [], "hasBadReviews": { "type": "danger", "text": "Yes", "origBValue": true, "origSValue": "Yes", "origNValue": null, "origDValue": null }, "relatedToOtherNotTrustedSites": { "type": "info", "text": "No", "origBValue": false, "origSValue": "No", "origNValue": null, "origDValue": null }, "theirServerIpIsMarkedAsAbusive": { "type": "danger", "text": "Yes", "origBValue": true, "origSValue": "Yes", "origNValue": null, "origDValue": null }, "hackedOrBeenHacked": { "type": "info", "text": "No", "origBValue": false, "origSValue": "No", "origNValue": null, "origDValue": null }, "firewallFound": { "type": "success", "text": "Fastly Hosted", "origBValue": true, "origSValue": "Cloudflare", "origNValue": null, "origDValue": null }, "markedAsRisk": { "type": "info", "text": "No", "origBValue": false, "origSValue": "No", "origNValue": null, "origDValue": null }, "siteAdult": { "type": "info", "text": "No", "origBValue": false, "origSValue": "No", "origNValue": null, "origDValue": null }, "nastyTags": [], "securityBadges": [] }, "sslInfo": { "hideSection": false, "subject": "\/CN=burton.co.uk", "startDate": "2025-06-27T00:00:00.000000Z", "expiryDate": "2025-09-25T00:00:00.000000Z", "valid": true }, "firewall": "Cloudflare", "blacklistStatus": [], "externalScans": [] }
Rankings & Traffic
Additional SEO Metrics
Backlinks & Indexing Statistics
{ "trustedRank": "Low Rating", "siteVisitors": "Moderate", "globalRank": "61596", "pageRank": 3.64, "googlebotvisit": "Dec 7, 2022 17:23:36 GMT", "googleindexed": "0", "bingindexed": "0", "yahooindexed": "0", "yahoodir": "1", "googlebacklinks": "8480", "yahoobacklinks": "0", "validrank": "0", "siteSpeed": "Slow", "numPageViews": 129, "webPresenceInfo": { "socialMedia": { "twitter": null, "facebook": { "name": "burton.co.uk", "username": "burton.co.uk", "url": "https://www.facebook.com/BurtonMenswear/", "likes": "548173", "followers": "541097", "checkins": "", "rating": "", "since": "2022-12-07 11:07:42", "profileImage": "" }, "linkedin": null, "instagram": null }, "businessListings": [], "newsReferences": [] } }
Global Sentiment Metrics
Keywords Analysis
Keyword | Frequency | Classification |
---|---|---|
DELIVERY |
17
|
Neutral |
SCAM |
14
|
Neutral |
CUSTOMER SERVICE |
14
|
Neutral |
PRODUCT |
9
|
Neutral |
FAKE |
4
|
Neutral |
PAYMENT |
|
Neutral |
WATCH |
|
Neutral |
Per-Source Sentiment Analysis
Trustpilot
SiteJabber
WebofTrust
ReviewsIO
{ "global": { "avgSentCom": "-0.13847209", "avgSentNeg": "0.10697674", "avgSentNeu": "0.80398837", "avgSentPos": "0.08908140", "numBad": 66, "numGood": 20, "badPerc": 76.74418604651163, "goodPerc": 23.25581395348837, "sentimentAnalyzedTotal": 86, "totalReviews": 1132, "ratingPerc": "37.906976744186046" }, "reviews": [ { "name": "Trustpilot", "sentiment": -25.4405, "stars": 1.8, "review_total": 1122, "keyword": [ "SCAM", "DELIVERY", "CUSTOMER SERVICE", "PRODUCT" ], "keyword_count": [ "6", "6", "6", "3" ], "word": [ "refund", "service", "missing", "absolutely", "burtons", "delivery", "delivered", "lost", "edit", "evri" ], "word_count": [ "10", "6", "4", "4", "4", "4", "4", "4", "4", "4" ] }, { "name": "SiteJabber", "sentiment": 16.4144444, "stars": 1.9, "review_total": 6, "keyword": [ "DELIVERY", "SCAM", "FAKE", "PRODUCT" ], "keyword_count": [ "3", "2", "2", "2" ], "word": [ "burtons", "cheap", "worst", "alzheimers", "charity", "area", "bargain", "blowing", "boycott", "boys" ], "word_count": [ "5", "3", "2", "2", "2", "2", "2", "2", "2", "2" ] }, { "name": "WebofTrust", "sentiment": 51.7566666, "stars": 4.8, "review_total": 3, "keyword": [ "CUSTOMER SERVICE" ], "keyword_count": [ "1" ], "word": [ "clothing", "designed", "eventually", "fashion", "good", "purchasing", "recommend", "retailers", "service", "sweater" ], "word_count": [ "1", "1", "1", "1", "1", "1", "1", "1", "1", "1" ] }, { "name": "ReviewsIO", "sentiment": -8.6748648, "stars": 5, "review_total": 1, "keyword": [ "DELIVERY", "CUSTOMER SERVICE", "SCAM", "PRODUCT", "FAKE", "PAYMENT" ], "keyword_count": [ "7", "6", "5", "3", "1", "1" ], "word": [ "service", "suit", "delivery", "helpful", "respond", "trousers", "joke", "great", "jacket", "refund" ], "word_count": [ "10", "7", "6", "6", "4", "4", "3", "3", "3", "3" ] } ], "keywords": [ { "keyword": "DELIVERY", "set_flag": null, "total": "17" }, { "keyword": "SCAM", "set_flag": "flag_scam_keyword", "total": "14" }, { "keyword": "CUSTOMER SERVICE", "set_flag": null, "total": "14" }, { "keyword": "PRODUCT", "set_flag": null, "total": "9" }, { "keyword": "FAKE", "set_flag": null, "total": "4" }, { "keyword": "PAYMENT", "set_flag": null, "total": "1" }, { "keyword": "WATCH", "set_flag": null, "total": "1" } ], "wordFrequency": [ { "word": "burton", "total": "41" }, { "word": "service", "total": "30" }, { "word": "refund", "total": "24" }, { "word": "delivery", "total": "23" }, { "word": "burtons", "total": "20" }, { "word": "suit", "total": "16" }, { "word": "return", "total": "13" }, { "word": "shame", "total": "12" }, { "word": "trousers", "total": "12" }, { "word": "delivered", "total": "11" } ], "benford": { "totalReviews": "86", "ratingPerc": "37.906976744186046", "numBad": "66", "numGood": "20", "avgSentCom": "-0.13847209", "avgSentNeg": "0.10697674", "avgSentNeu": "0.80398837", "avgSentPos": "0.08908140", "0": { "digit": "1", "total": "17", "perc": "19.1011", "base": 30.1 }, "1": { "digit": "4", "total": "16", "perc": "17.9775", "base": 9.7 }, "2": { "digit": "2", "total": "14", "perc": "15.7303", "base": 17.6 }, "3": { "digit": "3", "total": "13", "perc": "14.6067", "base": 12.5 }, "4": { "digit": "5", "total": "10", "perc": "11.2360", "base": 7.9 }, "5": { "digit": "9", "total": "7", "perc": "7.8652", "base": 4.6 }, "6": { "digit": "6", "total": "6", "perc": "6.7416", "base": 6.7 }, "7": { "digit": "8", "total": "3", "perc": "3.3708", "base": 5.1 }, "8": { "digit": "7", "total": "3", "perc": "3.3708", "base": 5.8 } }, "actualTotals": { "totalReviews": 1132, "averageRating": 1.8113074204947002, "sources": { "Trustpilot": 1122, "SiteJabber": 6, "WebofTrust": 3, "ReviewsIO": 1 }, "starDistribution": { "5": 56, "4": 113, "3": 169, "2": 342, "1": 452, "0": 0 } } }
Domain Details
Domain Registrar
Domain's Name Servers 4 servers
Domain | IP Address | Country | ISP | City | Postal Code |
---|---|---|---|---|---|
ns-621.awsdns-13.net | 205.251.194.109 |
United States
|
Amazon.com | Chicago | 60666 |
ns-1047.awsdns-02.org | 205.251.196.23 |
United States
|
Amazon.com, Inc. | Herndon | 20171 |
ns-148.awsdns-18.com | 205.251.192.148 |
United States
|
Amazon.com | Ashburn | 20149 |
ns-1769.awsdns-29.co.uk | 205.251.198.233 |
United States
|
Amazon.com | Ashburn | 20149 |
Domain | IP Address | Country | ISP | City | Postal Code |
---|---|---|---|---|---|
ns-621.awsdns-13.net
|
205.251.194.109 |
United States
|
Amazon.com
|
Chicago | 60666 |
ns-1047.awsdns-02.org
|
205.251.196.23 |
United States
|
Amazon.com, Inc.
|
Herndon | 20171 |
ns-148.awsdns-18.com
|
205.251.192.148 |
United States
|
Amazon.com
|
Ashburn | 20149 |
ns-1769.awsdns-29.co.uk
|
205.251.198.233 |
United States
|
Amazon.com
|
Ashburn | 20149 |
{ "domainNameInfo": { "hideSection": false, "registrarName": "EuroDNS SA", "registrarCountry": null, "registrarEmail": "", "registrarUrl": "", "registrarWhoIs": "", "age": "28 Years, 360 Days", "createdDate": null, "expirationDate": "2026-01-09T00:00:00.000000Z", "lastModifiedDate": "2025-01-02T00:00:00.000000Z", "owner": null, "admin": null, "technical": null, "billing": null, "whoisDataAge": "1" }, "registrar": { "name": "EuroDNS SA", "country": "LU", "ip": "80.92.65.210", "whois": "whois.nic.uk", "home": "eurodns.com" }, "contacts": { "owner": { "name": "", "org": "", "country": "", "email": "" }, "admin": { "name": "", "org": "", "country": "", "email": "" }, "technical": { "name": "", "org": "", "country": "", "email": "" } }, "nameServers": [ { "name": "ns-621.awsdns-13.net", "ip": "205.251.194.109", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "type": "NS", "city": "Chicago", "region": "", "postcode": "60666", "isp": "Amazon.com", "latitude": "41.8781", "longitude": "-87.6298" }, { "name": "ns-1047.awsdns-02.org", "ip": "205.251.196.23", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "type": "NS", "city": "Herndon", "region": "", "postcode": "20171", "isp": "Amazon.com, Inc.", "latitude": "38.9547", "longitude": "-77.4043" }, { "name": "ns-148.awsdns-18.com", "ip": "205.251.192.148", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "type": "NS", "city": "Ashburn", "region": "", "postcode": "20149", "isp": "Amazon.com", "latitude": "39.0438", "longitude": "-77.4874" }, { "name": "ns-1769.awsdns-29.co.uk", "ip": "205.251.198.233", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "type": "NS", "city": "Ashburn", "region": "", "postcode": "20149", "isp": "Amazon.com", "latitude": 39.0438, "longitude": -77.4874 } ], "dates": { "created": null, "expires": "2026-01-09T00:00:00.000000Z", "modified": "2025-01-02T00:00:00.000000Z" } }
Event Categories
Domain & Core
Web Archive History
Social & Reviews
Interactive Timeline
First Archived
February 3, 1998
ArchiveTwitter/X Joined
May 12, 2009
SocialFacebook Page Created
June 15, 2009
SocialFirst Review
November 20, 2012
SocialLast Archived
December 7, 2022
ArchiveTwitter/X Last Active
December 7, 2022
SocialDomain Modified
January 2, 2025
DomainLatest Review
July 16, 2025
SocialLogo | Technology | Description | Category | Popularity | First Seen |
---|---|---|---|---|---|
|
Remix
|
Remix
|
Web Servers |
|
Unknown |
|
Bloomreach Discovery
v17.1
|
Bloomreach Discovery
|
A/B Testing |
|
Unknown |
![]() |
RevLifter
|
AI-powered marketing technology and personalization.
|
Analytics and Tracking |
|
Unknown |
![]() |
Bazaarvoice Reviews
|
Bazaarvoice Reviews
|
Reviews |
|
Unknown |
![]() |
Exponea
v3.40.0
|
Omni-channel real-time marketing automation tool.
|
Analytics and Tracking |
|
Unknown |
![]() |
MainAd
|
Display and retargeting system.
|
Advertising |
|
Unknown |
![]() |
Forter
|
Fraud prevention decision as a service system.
|
Analytics and Tracking |
|
Unknown |
![]() |
AB Tasty
|
French based A/B testing solution.
|
Analytics and Tracking |
|
Unknown |
|
AWIN
|
AWIN
|
Affiliate programs |
|
Unknown |
|
Priority Hints
|
Priority Hints
|
Performance |
|
Unknown |
![]() |
Algolia
|
Algolia's Search API makes it possible to deliver a search experience in your apps & websites.
|
Widgets |
|
Unknown |
|
CookieYes
|
CookieYes
|
Cookie compliance |
|
Unknown |
![]() |
Microsoft Clarity
v0.8.19
|
Microsoft Clarity
|
Analytics and Tracking |
|
Unknown |
|
AWS Certificate Manager
|
AWS Certificate Manager
|
SSL/TLS certificate authorities |
|
Unknown |
![]() |
Open Graph
|
Open Graph
|
Miscellaneous |
|
Unknown |
![]() |
DoubleClick Floodlight
|
Floodlight is feature of DoubleClick ads that allows advertisers to capture and report on the actions of users who visit their website after viewing or clicking on one of the advertiser's ads.
|
Analytics and Tracking |
|
Unknown |
![]() |
Sectigo
|
Sectigo site seal formally Comodo CA.
|
Widgets |
|
Unknown |
![]() |
Amazon CloudFront
|
Amazon CloudFront delivers your static and streaming content using a global network of edge locations.
|
Verified CDN |
|
Unknown |
![]() |
React
|
A JavaScript library for building user interfaces from Facebook.
|
JavaScript Libraries and Functions |
|
Unknown |
![]() |
core-js
v3.6.4
|
Modular standard library for JavaScript.
|
JavaScript Libraries and Functions |
|
Unknown |
![]() |
Cart Functionality
|
The site has a link to a shopping cart which is not categorized under any of the cart technologies we track (custom implementation or not tracked yet).
|
eCommerce |
|
Unknown |
![]() |
HSTS
|
Forces browsers to only communicate with the site using HTTPS.
|
Document Standards |
|
Unknown |
![]() |
Amazon
|
This site is hosted on Amazon AWS EC2 Infrastructure.
|
Web Hosting Providers |
|
Unknown |
![]() |
Google Tag Manager
|
Tag management that lets you add and update website tags without changes to underlying website code.
|
Widgets |
|
Unknown |
![]() |
Cloudflare
|
Automatically optimizes the delivery of your web pages so your visitors get the fastest page load times and best performance.
|
Content Delivery Network |
|
Unknown |
![]() |
Google Analytics
vGA4
|
Google Analytics offers a host of compelling features and benefits for everyone from senior executives and advertising and marketing professionals to site owners and content developers.
|
Analytics and Tracking |
|
Unknown |
No Technologies Match Your Filter
Try adjusting your search terms or category filter
Hosting Provider
Network Infrastructure Protected
The information below shows the firewall infrastructure, not the origin server. This is actually a positive security indicator.
Shared Hosting Analysis 124 shared sites
Websites that have the same IP address as BURTON.CO.UK
Network Infrastructure
Performance Metrics
{ "hostingInfo": { "hideSection": false, "internetServiceProvider": "Amazon.com, Inc.", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "mostLikelyServerIp": "13.248.160.137", "serverLocation": "United States", "hostingProvider": "EasyRedir", "asn": "16509", "organizationName": "", "serverOS": "", "type": "" }, "ip": "13.248.160.137", "server": "EasyRedir", "netOrg": "Amazon.com, Inc.", "ipcountry": "us", "firewall": "Cloudflare", "registrar": "EuroDNS SA", "registrarCountry": "LU", "sharedIpSites": [ { "domain": "pjsautoworld.com", "rating": "25", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "foacommercial.com", "rating": "28", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "harrispestmackay.com.au", "rating": "49", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "janssen-deutschland.de", "rating": "80", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "branch.com", "rating": "91", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "portal.onewire.com", "rating": "95", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "corvettesandmusclecars.com", "rating": "99", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "donofriolawoffice.com", "rating": "100", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "esilicon.com", "rating": "101", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "gimbal.com", "rating": "105", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "millikenchemical.com", "rating": "106", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "athenasoftware.net", "rating": "106", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "preventice.com", "rating": "108", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "inphi.com", "rating": "108", "country": { "code": "CA", "name": "Canada", "flag": "\ud83c\udde8\ud83c\udde6" } }, { "domain": "cortina-systems.com", "rating": "109", "country": { "code": "AU", "name": "Australia", "flag": "\ud83c\udde6\ud83c\uddfa" } }, { "domain": "rochesterregionalhealth.org", "rating": "109", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "tads.com", "rating": "109", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "wella.co.uk", "rating": "110", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "swobodapestcontrol.com", "rating": "99", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "boohoo.fr", "rating": "27", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "finance.debenhams.com", "rating": "41", "country": { "code": "UK", "name": "United Kingdom", "flag": "\ud83c\uddec\ud83c\udde7" } }, { "domain": "pullsdirect.com", "rating": "42", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "my-wardrobe.com", "rating": "49", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "emerson-academy.org", "rating": "70", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "evolveclothing.com", "rating": "83", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "absolutepest.com", "rating": "84", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "winecoolerdirect.com", "rating": "86", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "quill-offers.com", "rating": "91", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "elizabeth-rose.com", "rating": "97", "country": { "code": "UK", "name": "United Kingdom", "flag": "\ud83c\uddec\ud83c\udde7" } }, { "domain": "channel5.com", "rating": "100", "country": { "code": "UK", "name": "United Kingdom", "flag": "\ud83c\uddec\ud83c\udde7" } }, { "domain": "build.acl.com", "rating": "105", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "parkerhill.org", "rating": "110", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "dorma-kaba.se", "rating": "96", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "datapointeurope.com", "rating": "105", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "dierenkliniekhattemwapenveld.nl", "rating": "107", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "northrocklanes.com", "rating": "108", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "mta-sts.mail.dorma-glas.de", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "vela.law", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "order.acuvue.dk", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "order.acuvue.it", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "processingpros.shop", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "ustapr.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "franchise.leesfamousrecipe.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "sales-lentz.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "interactivedatascience.org", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "techastra.statefarm.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "7z9aij8x.edge.easyredir.net", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "surveyresults.sallinggroup.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "conseillers.investia.ca", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "betterknowaballot.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "revanceu.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "thescoutsshop.com.au", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "mclainmilitarylawyer.com.cdn.cloudflare.net", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "elektramusicgroup.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "gerarddonderolaw.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "clappmoroney.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "scottadamssays.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "expresspipe.reece.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "cpanel.aerationsplusla.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "waterwisela.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "webdisk.aerationsplusla.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "webdisk.waterwisela.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "hello.digital22.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "video.digital22.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "prosperityws.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "botsy.app", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "absolutlaw.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "builders.co.ke", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "taylorprep.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "eternitydiamonds.us", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "abogadosdeaccidenteslosangeles.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "hardlinepest.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "neumannlawyers.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "caplansjewelry.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "tastethefloorrecords.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "profound-france.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "tegnamarketingsolutions.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "bodyguardian.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "boostclinical.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "boostis.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "infosensor.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "mybodyguardian.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "prevent1ce.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "prevent1ce.info", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "prevent1ce.us", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventice.cloud", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventice.eu", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventice.info", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventice.nl", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventice.site", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicegc.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicemail.biz", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicemail.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventices.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventiceservices.net", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventiceservices.org", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicesolution.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicesolutions.biz", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicesolutions.info", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicetechnologies.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicetechnologies.info", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicetest.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicetest2.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "polymerics.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "thinkministry.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "feacegif.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "feacfslf.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "driverdirectphysicals.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "geneseeorthopedics.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "the3dgift.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "cliniqueveterinairedesoultz.fr", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "cliniqueveterinairelapepiniere.fr", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "cliniqueveterinaireleshoublonnieres.fr", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "dormakaba.kz", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "bowlatparadise.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventice.us", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "sanfernandovalleylawyers.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "usfraudattorneys.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "nostalgicmotoringltd.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventice.biz", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "buyyoutubevideos.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "ryah.ca", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "hopkinsfirm.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "sjclassics.net", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } } ] }
Discovered Subdomains:
Subdomain | Country | Trust Rating | IP Address |
---|---|---|---|
m.burton.co.uk
Created: Jan 1, 1970
|
United States
|
Low Risk Site | 23.204.30.161 |
reviews.burton.co.uk
Created: Jan 1, 1970
|
United States
|
Low Risk Site | 23.206.251.160 |
IP Address History Timeline:
No Related Sites Found
No related websites were discovered for this domain
This indicates an isolated or independent web presence
Possibly Related Domains:
{ "subDomains": [ { "subdomain": "m.burton.co.uk", "name": "m.burton.co.uk", "ip": "23.204.30.161", "active": true, "status": "active", "rating": "76", "trustScore": "76", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "ipcountry": "us", "likelyCountry": "us", "discovered": "before Aug-1996", "lastChecked": "before Aug-1996", "title": "", "description": "" }, { "subdomain": "reviews.burton.co.uk", "name": "reviews.burton.co.uk", "ip": "23.206.251.160", "active": true, "status": "active", "rating": "100", "trustScore": "100", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "ipcountry": "us", "likelyCountry": "us", "discovered": "before Aug-1996", "lastChecked": "before Aug-1996", "title": "", "description": "" } ], "ipHistories": [ { "id": "36072246", "ip": "104.121.71.104", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "countryCode": "US", "detectedDate": "", "createTimestamp": "2019-01-08 16:51:56", "period": "Jan 8, 2019", "dateRange": "Jan 8, 2019", "current": false }, { "id": "20708108", "ip": "23.54.201.116", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "countryCode": "US", "detectedDate": "", "createTimestamp": "2018-01-07 20:19:56", "period": "Jan 7, 2018", "dateRange": "Jan 7, 2018", "current": false }, { "id": "9574728", "ip": "23.50.228.89", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "countryCode": "US", "detectedDate": "", "createTimestamp": "2017-03-30 19:32:00", "period": "Mar 30, 2017", "dateRange": "Mar 30, 2017", "current": false }, { "id": "30104465", "ip": "23.5.97.156", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "countryCode": "US", "detectedDate": "", "createTimestamp": "2018-10-07 18:34:42", "period": "Oct 7, 2018", "dateRange": "Oct 7, 2018", "current": false }, { "id": "20193421", "ip": "23.46.58.52", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "countryCode": "US", "detectedDate": "", "createTimestamp": "2017-12-21 03:59:50", "period": "Dec 21, 2017", "dateRange": "Dec 21, 2017", "current": false }, { "id": "19006561", "ip": "23.43.171.73", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "countryCode": "US", "detectedDate": "", "createTimestamp": "2017-11-15 09:27:33", "period": "Nov 15, 2017", "dateRange": "Nov 15, 2017", "current": false }, { "id": "12598794", "ip": "23.211.100.74", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "countryCode": "US", "detectedDate": "", "createTimestamp": "2017-08-10 19:48:16", "period": "Aug 10, 2017", "dateRange": "Aug 10, 2017", "current": false }, { "id": "34526296", "ip": "23.207.17.132", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "countryCode": "US", "detectedDate": "", "createTimestamp": "2018-12-19 09:15:46", "period": "Dec 19, 2018", "dateRange": "Dec 19, 2018", "current": false }, { "id": "11049092", "ip": "23.204.188.15", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "countryCode": "US", "detectedDate": "", "createTimestamp": "2017-05-29 09:59:00", "period": "May 29, 2017", "dateRange": "May 29, 2017", "current": false }, { "id": "11837491", "ip": "23.204.101.148", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "countryCode": "US", "detectedDate": "", "createTimestamp": "2017-07-14 04:48:22", "period": "Jul 14, 2017", "dateRange": "Jul 14, 2017", "current": false }, { "id": "19903867", "ip": "23.202.233.106", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "countryCode": "US", "detectedDate": "", "createTimestamp": "2017-12-07 19:33:33", "period": "Dec 7, 2017", "dateRange": "Dec 7, 2017", "current": false }, { "id": "17731667", "ip": "23.194.96.57", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "countryCode": "US", "detectedDate": "", "createTimestamp": "2017-10-08 23:24:37", "period": "Oct 8, 2017", "dateRange": "Oct 8, 2017", "current": false }, { "id": "7105415", "ip": "23.12.209.116", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "countryCode": "US", "detectedDate": "", "createTimestamp": "2016-12-27 12:23:21", "period": "Dec 27, 2016", "dateRange": "Dec 27, 2016", "current": false }, { "id": "14315542", "ip": "104.126.123.90", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "countryCode": "US", "detectedDate": "", "createTimestamp": "2017-09-01 04:13:45", "period": "Sep 1, 2017", "dateRange": "Sep 1, 2017", "current": false }, { "id": "36279983", "ip": "104.125.210.128", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "countryCode": "US", "detectedDate": "", "createTimestamp": "2019-01-12 22:51:23", "period": "Jan 12, 2019", "dateRange": "Jan 12, 2019", "current": false }, { "id": "11217318", "ip": "104.108.59.240", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "countryCode": "US", "detectedDate": "", "createTimestamp": "2017-06-11 05:16:19", "period": "Jun 11, 2017", "dateRange": "Jun 11, 2017", "current": false }, { "id": "39041298", "ip": "arcadiagroup.co.uk", "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" }, "countryCode": "XX", "detectedDate": "2022-12-07 11:08:44", "createTimestamp": "2022-12-07 11:08:44", "period": "Dec 7, 2022", "dateRange": "Dec 7, 2022", "current": false } ], "relatedSites": [], "totalSubdomains": 2, "totalIpChanges": 17, "totalRelatedSites": 0 }
Need programmatic access to this domain analysis data?
Facebook
Twitter