Is myfriendshotmom.com a Scam or Legit?
Protect yourself from scams with our advanced website reputation checker.
0
views
Site is likely from
United States
100
/ 100
High Risk
Caution
Trusted
Highly Trusted
|
Quick Jump:
Quick overview mode
Detailed technical analysis
Charts
Map
History
Technical
| Feature | Simple | Pro |
|---|---|---|
| Trust Score & Verdict | ||
| Basic Domain Info | ||
| Technical Analysis | ||
| Historical Data & Timeline | ||
| Interactive Location Map | ||
| Charts & Visualizations |
Both modes show the same trust analysis, Pro mode adds technical details for advanced users
Why We Scored It 100/100
AI Website Analysis
myfriendshotmom.com looks like a legit website. Please be aware myfriendshotmom.com appears to have adult content.
If you have any feedback on this website, please add a review to help others.
Model ScamCheckLLM-2
AI-powered Website Analysis
myfriendshotmom.com Preview
My Friend's Hot Mom | Older Women Fucking Young Studs
My Friend's Hot Mom by Naughty America is one of the oldest MILF & Cougar porn sites online. Hundreds of videos and the hottest moms you wanna fuck!
adult
Website Reputation
Domain Age
21 Years, 327 Days
Website Likely From
United States
Trust Rating
100/100
Highly Trusted
Security Analysis
SSL Certificate
All Good
Only 15 days left
Firewall Protection
Yes
External Scans
Clean
Related to other Risky Websites
No
Security Checks
4/4
100% security standards met
Reviews & Ratings
5.5
3 reviews
5 stars
3 (100.0%)
4 stars
0 (0.0%)
3 stars
0 (0.0%)
2 stars
0 (0.0%)
1 star
0 (0.0%)
0 stars
0 (0.0%)
WebofTrust (2 reviews)
2 weeks ago
Looks like myfriendshotmom.com has an average rating of 3.3 If you wish to know more or read the contents of these reviews then please visit WebofTrust
AroundTheWeb
2 weeks ago
The 1 reviews of myfriendshotmom.com look mainly positive. If you want to read more about myfriendshotmom.com then please headover to the the AroundTheWeb website.
AI-Powered Insights
Overall Text Sentiment Analysis
Based on written review content
0.00
NEUTRAL
What Others Are Saying
Community Discussion
Join the conversation! Share your experience with myfriendshotmom.com and help others make informed decisions
Verified Community
Moderated Discussions
FAQs
Common questions about myfriendshotmom.com website security analysis
Is myfriendshotmom.com safe to use?
Based on our comprehensive analysis, myfriendshotmom.com appears to be safe. Our security assessment gave it a trust score of 100/100.
Key factors analyzed:
- • SSL certificate validation and security
- • Domain age and registration details
- • Hosting location and infrastructure
- • Community reviews and reputation data
- • Blacklist checking across security databases
What do the trust scores mean?
Our trust scores range from 0-100 and indicate the overall safety and legitimacy of a website:
70-100 (Trusted):
Safe to use with confidence
50-69 (Caution):
Exercise caution, verify before use
0-49 (High Risk):
Avoid or use extreme caution
How accurate is this security analysis?
Our analysis combines multiple authoritative data sources and uses advanced algorithms to provide highly accurate assessments. However, no automated system is 100% perfect.
We recommend:
- • Using our analysis as one factor in your decision
- • Checking multiple review sources for important transactions
- • Trusting your instincts if something feels wrong
- • Being extra cautious with financial or personal information
What should I do if I encounter a scam website?
If you've encountered a scam website, take these immediate steps:
Immediate Actions:
- • Do not provide any personal or financial information
- • Close the website immediately
- • Run antivirus scan if you downloaded anything
- • Change passwords if you entered any credentials
Report the Scam:
- • Report to FTC at reportfraud.ftc.gov
- • Report to your local authorities
- • Submit a review on our platform to warn others
- • Share warnings with friends and family
Why does myfriendshotmom.com have this trust rating?
The trust rating for myfriendshotmom.com is based on multiple security and reputation factors:
Positive Factors:
- • Positive community feedback
- • No security warnings detected
Risk Factors:
- • No significant risks detected
Share this analysis
0
views
1
/100
Highly Trusted
High Risk
Caution
Trusted
|
Quick Jump:
Quick overview mode
Detailed technical analysis
Charts
Map
History
Technical
| Feature | Simple | Pro |
|---|---|---|
| Trust Score & Verdict | ||
| Basic Domain Info | ||
| Technical Analysis | ||
| Historical Data & Timeline | ||
| Interactive Location Map | ||
| Charts & Visualizations |
Both modes show the same trust analysis, Pro mode adds technical details for advanced users
AI Website Analysis
myfriendshotmom.com looks like a legit website. Please be aware myfriendshotmom.com appears to have adult content.
If you have any feedback on this website, please add a review to help others.
Model ScamCheckLLM-2
AI-powered Website Analysis
myfriendshotmom.com Preview
My Friend's Hot Mom | Older Women Fucking Young Studs
My Friend's Hot Mom by Naughty America is one of the oldest MILF & Cougar porn sites online. Hundreds of videos and the hottest moms you wanna fuck!
adult
✓ Copied!
Site Information
Title:
My Friend's Hot Mom | Older Women Fucking Young Studs
Description:
My Friend's Hot Mom by Naughty America is one of the oldest MILF & Cougar porn sites online. Hundreds of videos and the hottest moms you wanna fuck!
Favicon:
Categories:
Adult
Key Statistics
Domain Age:
21 Years, 327 Days
Domain Expires:
Dec 5, 2025
Estimated Value:
$5.8K
Global Rank:
695895
Page Views:
1
Site Visitors:
Low
Site Speed:
Very Fast
Traffic Level:
Fair
Adult Content:
Yes
Geographic Information
Most Likely Country:
🇺🇸
United States
Confidence Level:
89%
Based on 1000's of AI GEO analysis checks
Social Media Presence
1 social network detected
126.2k
Followers
Business Contact Details
Organization:
tonightsgf
Business Address:
Now Playing...
{
"domain": null,
"title": "My Friend's Hot Mom | Older Women Fucking Young Studs",
"description": "My Friend's Hot Mom by Naughty America is one of the oldest MILF & Cougar porn sites online. Hundreds of videos and the hottest moms you wanna fuck!",
"age": "21 Years, 327 Days",
"value": "$5.8K",
"country": "United States",
"coordinates": "47.4815, -122.246",
"lastChecked": "2025-10-26T12:08:00.000000Z",
"categories": null
}
Risk Indicators
2Anonymous WHOIS
Sign up to view
Generic Address
Trust Indicators
2Sign up to view
Protected by Firewall
Strong Social Media
SSL & Certificates
Valid SSL Certificate:
All Good
SSL Certificate:
/CN=myfriendshotmom.com
SSL Valid From:
2025-08-29
Issued:
75 days ago
SSL Valid To:
2025-11-27
Expires In:
Only 15 days left
{
"securityInfo": {
"hideSection": false,
"sslValid": {
"type": "success",
"text": "All Good",
"origBValue": true,
"origSValue": "All Good",
"origNValue": null
},
"sslName": "\/CN=myfriendshotmom.com",
"sslValidFrom": {
"type": "primary",
"text": "2025-08-29",
"origSValue": "2025-08-29",
"origBValue": null,
"origNValue": null
},
"sslValidFromDaysAgo": {
"type": "success",
"text": "75 days ago",
"origNValue": -75,
"origSValue": "75 days ago",
"origBValue": null
},
"sslValidTo": {
"type": "primary",
"text": "2025-11-27",
"origSValue": "2025-11-27",
"origBValue": null,
"origNValue": null
},
"sslValidToDaysLeft": {
"type": "warning",
"text": "Only 15 days left",
"origNValue": 15,
"origSValue": "Only 15 days left",
"origBValue": null
},
"redirectsToHTTPS": [],
"hasBadReviews": {
"type": "info",
"text": "No",
"origBValue": false,
"origSValue": "No",
"origNValue": null,
"origDValue": null
},
"relatedToOtherNotTrustedSites": {
"type": "info",
"text": "No",
"origBValue": false,
"origSValue": "No",
"origNValue": null,
"origDValue": null
},
"theirServerIpIsMarkedAsAbusive": {
"type": "info",
"text": "No",
"origBValue": false,
"origSValue": "No",
"origNValue": null,
"origDValue": null
},
"hackedOrBeenHacked": {
"type": "info",
"text": "No",
"origBValue": false,
"origSValue": "No",
"origNValue": null,
"origDValue": null
},
"firewallFound": {
"type": "success",
"text": "Yes",
"origBValue": true,
"origSValue": "Yes",
"origNValue": null,
"origDValue": null
},
"markedAsRisk": {
"type": "info",
"text": "No",
"origBValue": false,
"origSValue": "No",
"origNValue": null,
"origDValue": null
},
"siteAdult": {
"type": "danger",
"text": "Yes",
"origBValue": true,
"origSValue": "Yes",
"origNValue": null,
"origDValue": null
},
"nastyTags": [],
"securityBadges": []
},
"sslInfo": {
"hideSection": false,
"subject": "\/CN=myfriendshotmom.com",
"startDate": "2025-08-29T00:00:00.000000Z",
"expiryDate": "2025-11-27T00:00:00.000000Z",
"valid": true
},
"firewall": "",
"blacklistStatus": [],
"externalScans": []
}
Rankings & Traffic
Current Global Rank:
#695,895
Low
Current Page Rank:
2.550
Medium
{
"trustedRank": "Low Rating",
"siteVisitors": "Low",
"globalRank": "695895",
"pageRank": "2.550",
"googlebotvisit": "Nov 16, 2016 01:04:19 GMT",
"googleindexed": "0",
"bingindexed": "0",
"yahooindexed": "0",
"yahoodir": "1",
"googlebacklinks": "0",
"yahoobacklinks": "0",
"validrank": "0",
"siteSpeed": "Very Fast",
"numPageViews": 1,
"webPresenceInfo": {
"socialMedia": {
"twitter": null,
"facebook": null,
"linkedin": null,
"instagram": null
},
"businessListings": [],
"newsReferences": []
},
"previousRank": [
{
"id": "190538",
"globalrank": "695895",
"opr_globalrank": "22115218",
"opr_pagerank": "3",
"tldrank": "314192",
"domain": "myfriendshotmom.com",
"tld": null,
"refsubnets": "380",
"refips": "572",
"idn_domain": "myfriendshotmom.com",
"idn_tld": "com",
"prevglobalrank": "697965",
"prevtldrank": "315502",
"prevrefsubnets": "378",
"prevrefips": "566",
"create_update_timestamp": "2025-10-26 12:09:02"
}
],
"previousRank_count": 1
}
Global Sentiment Metrics Sentiment Metrics
Combined
Overall sentiment score (-1 to +1). Negative values indicate critical reviews, positive values indicate favorable reviews.
0.000
Negative
Average negative sentiment intensity. Higher values indicate more strongly negative reviews.
0.000
0.0%
Neutral
Average neutral sentiment. Reviews that are neither strongly positive nor negative.
0.000
Most common sentiment
Common
Positive
Average positive sentiment intensity. Higher values indicate more strongly positive reviews.
0.000
0.0%
✓ Copied!
Keywords Analysis
BAD CUSTOMER SERVICE
Frequency
2
2
Negative
| Keyword | Frequency | Classification |
|---|---|---|
| BAD CUSTOMER SERVICE |
2
|
Negative |
Per-Source Sentiment Analysis
WebofTrust
2 reviews
•
3.5 stars
0.00
Source-specific sentiment (-1 to +1). Calculated from 2 reviews with 3.3 average stars.
AroundTheWeb
1 reviews
•
10.0 stars
0.00
Source-specific sentiment (-1 to +1). Calculated from 1 review with 10 average stars.
{
"global": {
"avgSentCom": null,
"avgSentNeg": null,
"avgSentNeu": null,
"avgSentPos": null,
"numBad": 0,
"numGood": 0,
"badPerc": 0,
"goodPerc": 0,
"sentimentAnalyzedTotal": 0,
"totalReviews": 3,
"ratingPerc": 0
},
"reviews": [
{
"name": "WebofTrust",
"sentiment": 0,
"stars": 3.3,
"review_total": 2,
"keyword": [],
"keyword_count": [],
"word": [
"situs",
"untuk",
"dewasa",
"imanmu",
"khusus",
"orang",
"tabahkan",
"anak-anak",
"berbahaya",
"didalam"
],
"word_count": [
"4",
"4",
"2",
"2",
"2",
"2",
"2",
"2",
"2",
"2"
]
},
{
"name": "AroundTheWeb",
"sentiment": 0,
"stars": 10,
"review_total": 1,
"keyword": [],
"keyword_count": [],
"word": [],
"word_count": []
}
],
"keywords": [
{
"keyword": "BAD CUSTOMER SERVICE",
"set_flag": null,
"type": "F",
"good_bad": "B",
"total": "2"
}
],
"wordFrequency": [
{
"word": "situs",
"total": "6"
},
{
"word": "untuk",
"total": "6"
},
{
"word": "anak-anak",
"total": "3"
},
{
"word": "berbahaya",
"total": "3"
},
{
"word": "dewasa",
"total": "3"
},
{
"word": "didalam",
"total": "3"
},
{
"word": "imanmu",
"total": "3"
},
{
"word": "khusus",
"total": "3"
},
{
"word": "orang",
"total": "3"
},
{
"word": "pornografi",
"total": "3"
}
],
"benford": {
"totalReviews": "0",
"ratingPerc": null,
"numBad": null,
"numGood": null,
"avgSentCom": null,
"avgSentNeg": null,
"avgSentNeu": null,
"avgSentPos": null,
"0": {
"digit": "5",
"total": "1",
"perc": "50.0000",
"base": 7.9
},
"1": {
"digit": "6",
"total": "1",
"perc": "50.0000",
"base": 6.7
}
},
"actualTotals": {
"totalReviews": 3,
"averageRating": 5.533333333333334,
"sources": {
"WebofTrust": 2,
"AroundTheWeb": 1
},
"starDistribution": {
"5": 3,
"4": 0,
"3": 0,
"2": 0,
"1": 0,
"0": 0
}
}
}
Domain Details
Domain Extension:
.com
Domain's Age:
21 Years, 327 Days
Created Date:
Dec 5, 2003 12:00 AM
Expires On:
Dec 5, 2025 12:00 AM
Domain Registrar
Domain WHOIS Information
Privacy Protection Notice
Most modern domain registrations use privacy protection services. Contact details may be redacted or replaced with privacy service information to protect registrant identity.
Domain's Name Servers 4 servers
| Domain | IP Address | Country | ISP | City | Postal Code |
|---|---|---|---|---|---|
| ns-1838.awsdns-37.co.uk | 205.251.199.46 |
United States
|
Amazon.com | Ashburn | 20149 |
| ns-1216.awsdns-24.org | 205.251.196.192 |
United States
|
Amazon.com, Inc. | Herndon | 20171 |
| ns-124.awsdns-15.com | 205.251.192.124 |
United States
|
Amazon.com | Ashburn | 20149 |
| ns-543.awsdns-03.net | 205.251.194.31 |
United States
|
Amazon.com | Chicago | 60666 |
| Domain | IP Address | Country | ISP | City | Postal Code |
|---|---|---|---|---|---|
|
ns-1838.awsdns-37.co.uk
|
205.251.199.46 |
United States
|
Amazon.com
|
Ashburn | 20149 |
|
ns-1216.awsdns-24.org
|
205.251.196.192 |
United States
|
Amazon.com, Inc.
|
Herndon | 20171 |
|
ns-124.awsdns-15.com
|
205.251.192.124 |
United States
|
Amazon.com
|
Ashburn | 20149 |
|
ns-543.awsdns-03.net
|
205.251.194.31 |
United States
|
Amazon.com
|
Chicago | 60666 |
{
"domainNameInfo": {
"hideSection": false,
"registrarName": "GoDaddy.com, LLC",
"registrarCountry": null,
"registrarEmail": "[email protected]",
"registrarUrl": "",
"registrarWhoIs": "",
"age": "21 Years, 327 Days",
"createdDate": "2003-12-05T00:00:00.000000Z",
"expirationDate": "2025-12-05T00:00:00.000000Z",
"lastModifiedDate": null,
"owner": {
"name": "Registration Private",
"organization": "Domains By Proxy, LLC",
"email": "[email protected]",
"phone": "480-624-2505",
"fax": "",
"street": "DomainsByProxy.com 100 S. Mill Ave, Suite 1600",
"city": "Tempe",
"state": "Arizona",
"postalCode": "85281",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
"admin": {
"name": "Registration Private",
"organization": "Domains By Proxy, LLC",
"email": "[email protected]",
"phone": "480-624-2505",
"fax": "",
"street": "DomainsByProxy.com 100 S. Mill Ave, Suite 1600",
"city": "Tempe",
"state": "Arizona",
"postalCode": "85281",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
"technical": {
"name": "Registration Private",
"organization": "",
"email": "[email protected]",
"phone": "480-624-2505",
"fax": "",
"street": "DomainsByProxy.com 100 S. Mill Ave, Suite 1600",
"city": "Tempe",
"state": "Arizona",
"postalCode": "85281",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
"billing": null,
"whoisDataAge": "2"
},
"registrar": {
"name": "GoDaddy.com, LLC",
"country": "",
"ip": "",
"whois": "",
"home": ""
},
"contacts": {
"owner": {
"name": "Registration Private",
"org": "Domains By Proxy, LLC",
"country": "US",
"email": "[email protected]"
},
"admin": {
"name": "Registration Private",
"org": "Domains By Proxy, LLC",
"country": "US",
"email": "[email protected]"
},
"technical": {
"name": "Registration Private",
"org": "",
"country": "US",
"email": "[email protected]"
}
},
"nameServers": [
{
"name": "ns-1838.awsdns-37.co.uk",
"ip": "205.251.199.46",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"type": "NS",
"city": "Ashburn",
"region": "",
"postcode": "20149",
"isp": "Amazon.com",
"latitude": "39.0438",
"longitude": "-77.4874"
},
{
"name": "ns-1216.awsdns-24.org",
"ip": "205.251.196.192",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"type": "NS",
"city": "Herndon",
"region": "",
"postcode": "20171",
"isp": "Amazon.com, Inc.",
"latitude": "38.9547",
"longitude": "-77.4043"
},
{
"name": "ns-124.awsdns-15.com",
"ip": "205.251.192.124",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"type": "NS",
"city": "Ashburn",
"region": "",
"postcode": "20149",
"isp": "Amazon.com",
"latitude": "39.0438",
"longitude": "-77.4874"
},
{
"name": "ns-543.awsdns-03.net",
"ip": "205.251.194.31",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"type": "NS",
"city": "Chicago",
"region": "",
"postcode": "60666",
"isp": "Amazon.com",
"latitude": "41.8781",
"longitude": "-87.6298"
}
],
"dates": {
"created": "2003-12-05T00:00:00.000000Z",
"expires": "2025-12-05T00:00:00.000000Z",
"modified": null
}
}
Event Categories
Domain & Core
Social & Reviews
Technical Events
Interactive Timeline
Timeline Span:
Domain Created
December 5, 2003
DomainTwitter/X Joined
November 1, 2009
SocialFirst Review
January 7, 2010
SocialLatest Review
January 7, 2010
SocialLast Updated
October 26, 2025
TechnicalDomain Expires
December 5, 2025
DomainTotal Events
2
Domain
0
Archive
3
Social
35
Technologies
18
Categories
35
Popular
0
Recent
Filtered results
| Logo | Technology | Description | Category | Popularity | First Seen |
|---|---|---|---|---|---|
|
web-vitals
|
web-vitals
|
RUM |
|
Unknown |
|
Adobe Fonts
|
Adobe Fonts
|
Font scripts |
|
Unknown |
|
Amazon Elastic Load Balancing
|
Elastic Load Balancing automatically distributes incoming application traffic across multiple Amazon EC2 instances in the cloud.
|
Web Hosting Providers |
|
Unknown |
|
NSONE
|
NSONE delivers data driven DNS with enterprise level support and transparent pricing.
|
Name Server |
|
Unknown |
|
Apache HTTP Server
v2.4.41
|
Apache HTTP Server
|
Web Servers |
|
Unknown |
|
AWS Certificate Manager
|
AWS Certificate Manager
|
SSL/TLS certificate authorities |
|
Unknown |
|
Optimizely
|
Optimizely empowers companies to deliver more relevant and effective digital experiences on websites and mobile through A/B testing and personalization.
|
Analytics and Tracking |
|
Unknown |
|
UNPKG
|
unpkg is a fast, global content delivery network for everything on npm.
|
Content Delivery Network |
|
Unknown |
|
Google Conversion Linker
|
Detects the ad click information in your conversion page URLs and stores this information to associate an ad click with a conversion.
|
Analytics and Tracking |
|
Unknown |
|
DoubleClick Floodlight
|
Floodlight is feature of DoubleClick ads that allows advertisers to capture and report on the actions of users who visit their website after viewing or clicking on one of the advertiser's ads.
|
Analytics and Tracking |
|
Unknown |
|
lazySizes
|
Lazy loader for images (responsive and normal), iframes and scripts, that detects any visibility changes triggered through user interaction, CSS or JavaScript without configuration.
|
JavaScript Libraries and Functions |
|
Unknown |
|
Typekit
|
Typekit is the easiest way to use real fonts on the web. It's a subscription-based service for linking to high-quality Open Type fonts from some of the worlds best type foundries.
|
Widgets |
|
Unknown |
|
New Relic
|
New Relic is a dashboard used to keep an eye on application health and availability while monitoring real user experience.
|
Analytics and Tracking |
|
Unknown |
|
Amazon S3 CDN
|
Amazon S3 is storage for the Internet. It is designed to make web-scale computing easier for developers.
|
Verified CDN |
|
Unknown |
|
Ubuntu
|
Ubuntu is a free, Debian derived Linux-based operating system, available with both community and professional support.
|
Operating Systems and Servers |
|
Unknown |
|
Google Remarketing
|
Google code specifically for remarketing/retargeting based advertising.
|
Advertising |
|
Unknown |
|
Google Conversion Tracking
|
This free tool in AdWords can show you what happens after customers click your ad (for example, whether they purchased your product, called from a mobile phone or downloaded your app).
|
Analytics and Tracking |
|
Unknown |
|
jQuery CDN
|
The JQuery Amazon S3 Content Delivery Network
|
Content Delivery Network |
|
Unknown |
|
Amazon
|
This site is hosted on Amazon AWS EC2 Infrastructure.
|
Web Hosting Providers |
|
Unknown |
|
Bootstrap.js
v16
|
Twitter Bootstrap JS components.
|
JavaScript Libraries and Functions |
|
Unknown |
|
Global Site Tag
|
Google's primary tag for Google Measurement/Conversion Tracking, Adwords and DoubleClick.
|
Analytics and Tracking |
|
Unknown |
|
Google Webmaster
|
Webmaster tools provide you with a free and easy way to make your site more Google-friendly.
|
Web Master Registration |
|
Unknown |
|
Google Hosted Libraries
|
Google Hosted Libraries is a globally available content distribution network for the most popular, open-source JavaScript libraries.
|
JavaScript Libraries and Functions |
|
Unknown |
|
LetsEncrypt
|
Let’s Encrypt is a free open Certificate Authority.
|
SSL Certificates |
|
Unknown |
|
Google Tag Manager
|
Tag management that lets you add and update website tags without changes to underlying website code.
|
Widgets |
|
Unknown |
|
Content Delivery Network
|
This page contains links that give the impression that some of the site contents are stored on a content delivery network.
|
Content Delivery Network |
|
Unknown |
|
SSL by Default
|
The website redirects traffic to an HTTPS/SSL version by default.
|
SSL Certificates |
|
Unknown |
|
Google Analytics
|
Google Analytics offers a host of compelling features and benefits for everyone from senior executives and advertising and marketing professionals to site owners and content developers.
|
Analytics and Tracking |
|
Unknown |
|
PHP
|
PHP is a widely-used general-purpose scripting language that is especially suited for Web development and can be embedded into HTML.
|
Frameworks |
|
Unknown |
|
SPF
|
The Sender Policy Framework is an open standard specifying a technical method to prevent sender address forgery.
|
Email Hosting Providers |
|
Unknown |
|
Apache
|
Apache has been the most popular web server on the Internet since April 1996.
|
Web Servers |
|
Unknown |
|
Google Font API
|
The Google Font API helps you add web fonts to any web page.
|
Widgets |
|
Unknown |
|
IPhone / Mobile Compatible
|
The website contains code that allows the page to support IPhone / Mobile Content.
|
Mobile |
|
Unknown |
|
Viewport Meta
|
This page uses the viewport meta tag which means the content may be optimized for mobile content.
|
Mobile |
|
Unknown |
|
jQuery
|
JQuery is a fast, concise, JavaScript Library that simplifies how you traverse HTML documents, handle events, perform animations, and add Ajax interactions to your web pages. jQuery is designed to change the way that you write JavaScript.
|
JavaScript Libraries and Functions |
|
Unknown |
Page
of
No Technologies Match Your Filter
Try adjusting your search terms or category filter
Hosting Provider
Hosting Provider:
EasyRedir
ISP:
Amazon.com, Inc.
ASN:
AS16509
Network Infrastructure Protected
Firewall Protection Detected
The information below shows the firewall infrastructure, not the origin server. This is actually a positive security indicator.
Network IP Address:
13.248.160.137
Network Location:
United States
Coordinates:
47.4815, -122.2460
Network Location:
Distance:
5280 km away
Shared Hosting Analysis 204 shared sites
Websites that have the same IP address as MYFRIENDSHOTMOM.COM
Low Risk
Australia
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
Singapore
Low Risk
United States
Low Risk
United States
Low Risk
United Kingdom
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United Kingdom
Low Risk
United States
Low Risk
United States
Low Risk
United Kingdom
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United Kingdom
Low Risk
United States
Low Risk
Sweden
Low Risk
Germany
Low Risk
Germany
Low Risk
United States
Low Risk
United States
Low Risk
Germany
Low Risk
Canada
Low Risk
United States
Low Risk
United Kingdom
Low Risk
Germany
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United Kingdom
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
Ireland
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
Belgium
Low Risk
United States
Low Risk
United States
Low Risk
Canada
Low Risk
United States
Low Risk
United States
Low Risk
Kenya
Low Risk
Sweden
Low Risk
United States
Low Risk
United States
Low Risk
United Kingdom
Low Risk
United States
Low Risk
United States
Low Risk
France
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
Germany
Low Risk
United States
Low Risk
United States
Low Risk
Canada
Low Risk
Canada
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
Canada
Low Risk
Canada
Low Risk
Canada
Low Risk
Germany
Low Risk
United Kingdom
Low Risk
United States
Low Risk
United Kingdom
Low Risk
Spain
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United Kingdom
Low Risk
Germany
Low Risk
United States
Low Risk
Canada
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United Kingdom
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
Sweden
Low Risk
Canada
Low Risk
Canada
Low Risk
Canada
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Low Risk
United States
Page of
Network Infrastructure
Performance Metrics
Site Speed:
Very Fast
Server Status:
Online
{
"hostingInfo": {
"hideSection": false,
"internetServiceProvider": "Amazon.com, Inc.",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"mostLikelyServerIp": "13.248.160.137",
"serverLocation": "United States",
"hostingProvider": "EasyRedir",
"asn": "16509",
"organizationName": "",
"serverOS": "",
"type": ""
},
"ip": "13.248.160.137",
"server": "EasyRedir",
"netOrg": "Amazon.com, Inc.",
"ipcountry": "us",
"firewall": "",
"registrar": "GoDaddy.com, LLC",
"registrarCountry": "",
"sharedIpSites": [
{
"domain": "harrispestmackay.com.au",
"rating": "1",
"country": {
"code": "AU",
"name": "Australia",
"flag": "\ud83c\udde6\ud83c\uddfa"
}
},
{
"domain": "branch.com",
"rating": "63",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "athenasoftware.net",
"rating": "93",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "portal.onewire.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "cortina-systems.com",
"rating": "98",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "janssen-deutschland.de",
"rating": "98",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "esilicon.com",
"rating": "98",
"country": {
"code": "SG",
"name": "Singapore",
"flag": "\ud83c\uddf8\ud83c\uddec"
}
},
{
"domain": "corvettesandmusclecars.com",
"rating": "99",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "rochesterregionalhealth.org",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "sg.dorothyperkins.com",
"rating": "100",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "tads.com",
"rating": "109",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "wella.co.uk",
"rating": "110",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "swobodapestcontrol.com",
"rating": "85",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "euro.dorothyperkins.com",
"rating": "1",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "boohoo.fr",
"rating": "27",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "dorothyperkins.com",
"rating": "41",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "finance.debenhams.com",
"rating": "41",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "pullsdirect.com",
"rating": "42",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "airceldryers.com",
"rating": "46",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "pjsautoworld.com",
"rating": "50",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "de.dorothyperkins.com",
"rating": "50",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "foacommercial.com",
"rating": "50",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "ryah.ca",
"rating": "50",
"country": {
"code": "SE",
"name": "Sweden",
"flag": "\ud83c\uddf8\ud83c\uddea"
}
},
{
"domain": "cifial.faucetdirect.com",
"rating": "50",
"country": {
"code": "DE",
"name": "Germany",
"flag": "\ud83c\udde9\ud83c\uddea"
}
},
{
"domain": "grohe.faucetdirect.com",
"rating": "50",
"country": {
"code": "DE",
"name": "Germany",
"flag": "\ud83c\udde9\ud83c\uddea"
}
},
{
"domain": "resetpassword.sonesta.com",
"rating": "50",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "unlockaccount.sonesta.com",
"rating": "50",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "eco.improvementdirect.com",
"rating": "50",
"country": {
"code": "DE",
"name": "Germany",
"flag": "\ud83c\udde9\ud83c\uddea"
}
},
{
"domain": "prosperityws.com",
"rating": "50",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "hopkinsfirm.com",
"rating": "52",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "direct.matalan.co.uk",
"rating": "52",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "ametektest.com",
"rating": "52",
"country": {
"code": "DE",
"name": "Germany",
"flag": "\ud83c\udde9\ud83c\uddea"
}
},
{
"domain": "improvementdirect.com",
"rating": "57",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "beachbodycert.com",
"rating": "62",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "supply.com",
"rating": "62",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "gerarddonderolaw.com",
"rating": "64",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "the3dgift.com",
"rating": "66",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "emerson-academy.org",
"rating": "70",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "vistacharteracademy.org",
"rating": "70",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "kylieskin.com",
"rating": "72",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "burton.co.uk",
"rating": "81",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "bookings.debenhams.com",
"rating": "81",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "allsportstore.com",
"rating": "82",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "parkerhill.org",
"rating": "83",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "evolveclothing.com",
"rating": "83",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "campingworld.co.uk",
"rating": "84",
"country": {
"code": "IE",
"name": "Ireland",
"flag": "\ud83c\uddee\ud83c\uddea"
}
},
{
"domain": "absolutepest.com",
"rating": "84",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "winecoolerdirect.com",
"rating": "86",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "expresspipe.reece.com",
"rating": "86",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "grandriveracademy.org",
"rating": "86",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "sundaemuse.com",
"rating": "90",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "inphi.com",
"rating": "90",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "patientwise.com",
"rating": "92",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "incontact.globalindustrial.com",
"rating": "92",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "order.acuvue.it",
"rating": "92",
"country": {
"code": "BE",
"name": "Belgium",
"flag": "\ud83c\udde7\ud83c\uddea"
}
},
{
"domain": "my.globalindustrial.com",
"rating": "92",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "beachbody.co.uk",
"rating": "94",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "donofriolawoffice.com",
"rating": "94",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "millikenchemical.com",
"rating": "94",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "getnexar.ourbranch.com",
"rating": "94",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "builders.co.ke",
"rating": "94",
"country": {
"code": "KE",
"name": "Kenya",
"flag": "\ud83c\uddf0\ud83c\uddea"
}
},
{
"domain": "cliniqueveterinairelapepiniere.fr",
"rating": "94",
"country": {
"code": "SE",
"name": "Sweden",
"flag": "\ud83c\uddf8\ud83c\uddea"
}
},
{
"domain": "bodybeast.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "collegesugarbabes.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "trutex.com",
"rating": "95",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "preventice.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "hardandalone.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "quill-offers.com",
"rating": "95",
"country": {
"code": "FR",
"name": "France",
"flag": "\ud83c\uddeb\ud83c\uddf7"
}
},
{
"domain": "preventice.us",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "andrewwomack.org",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "prod-cnaluxury.channelnewsasia.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "ftp.vanitiesdepot.com",
"rating": "95",
"country": {
"code": "DE",
"name": "Germany",
"flag": "\ud83c\udde9\ud83c\uddea"
}
},
{
"domain": "pfister.faucetdirect.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "status.golfnow.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "order.acuvue.dk",
"rating": "95",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "conseillers.investia.ca",
"rating": "95",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "worldimports.faucetdirect.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "ask.sonesta.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "eternitydiamonds.us",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "prevent1ce.us",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "preventicegc.com",
"rating": "95",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "preventicesolution.com",
"rating": "95",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "preventicetechnologies.com",
"rating": "95",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "wearencs.com",
"rating": "95",
"country": {
"code": "DE",
"name": "Germany",
"flag": "\ud83c\udde9\ud83c\uddea"
}
},
{
"domain": "bca.dk",
"rating": "95",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "slimin6.com",
"rating": "96",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "cvvillas.com",
"rating": "96",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "lookandfashion.hola.com",
"rating": "96",
"country": {
"code": "ES",
"name": "Spain",
"flag": "\ud83c\uddea\ud83c\uddf8"
}
},
{
"domain": "b-y.com",
"rating": "96",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "betterknowaballot.com",
"rating": "96",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "tastethefloorrecords.com",
"rating": "96",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "thinkministry.com",
"rating": "96",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "elizabeth-rose.com",
"rating": "97",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "careers.build.com",
"rating": "97",
"country": {
"code": "DE",
"name": "Germany",
"flag": "\ud83c\udde9\ud83c\uddea"
}
},
{
"domain": "preventice.cloud",
"rating": "97",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "preventicetest.com",
"rating": "97",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "cdx.bostonscientific.com",
"rating": "97",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "selfservice.sonesta.com",
"rating": "99",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "tiesto.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "jack-wolfskin.com",
"rating": "100",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "Jnj.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "wallis.co.uk",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "collegeboard.org",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "breville.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "waylandgames.co.uk",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "dv8fashion.co.uk",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "bostonscientific.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "gimbal.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "wmgartistservices.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "thepethealthclub.co.uk",
"rating": "100",
"country": {
"code": "SE",
"name": "Sweden",
"flag": "\ud83c\uddf8\ud83c\uddea"
}
},
{
"domain": "mybodyguardian.com",
"rating": "100",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "preventicetechnologies.info",
"rating": "100",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "meanwell-packaging.co.uk",
"rating": "100",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "build.acl.com",
"rating": "105",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "boohoo.co.uk",
"rating": "65",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "dorma-kaba.se",
"rating": "96",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "datapointeurope.com",
"rating": "105",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "dierenkliniekhattemwapenveld.nl",
"rating": "107",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "northrocklanes.com",
"rating": "108",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "mybenefits.globalindustrial.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "qms.globalindustrial.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "training.globalindustrial.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "tetrapak.cn.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "data.ourbranch.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "simplisafe.ourbranch.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "gmail.build.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "pricepfister.faucetdirect.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "jacuzzi.faucetdirect.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "blanco.faucetdirect.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "hansgrohe.faucetdirect.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "bemis.faucetdirect.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "moen.faucetdirect.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "webinar.sonesta.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "services.net-a-porter.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "vex.net-a-porter.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "box.sonesta.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "walktoschool.com.au",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "mta-sts.mail.dorma-glas.de",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "vela.law",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "processingpros.shop",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "ustapr.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "franchise.leesfamousrecipe.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "sales-lentz.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "interactivedatascience.org",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "techastra.statefarm.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "7z9aij8x.edge.easyredir.net",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "surveyresults.sallinggroup.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "revanceu.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "thescoutsshop.com.au",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "mclainmilitarylawyer.com.cdn.cloudflare.net",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "elektramusicgroup.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "clappmoroney.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "scottadamssays.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "cpanel.aerationsplusla.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "waterwisela.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "webdisk.aerationsplusla.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "webdisk.waterwisela.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "hello.digital22.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "video.digital22.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "mail.build.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "botsy.app",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "absolutlaw.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "taylorprep.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "abogadosdeaccidenteslosangeles.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "hardlinepest.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "neumannlawyers.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "caplansjewelry.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "profound-france.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "tegnamarketingsolutions.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "m-uat.debenhams.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "bodyguardian.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "boostclinical.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "boostis.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "infosensor.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "prevent1ce.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "prevent1ce.info",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventice.eu",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventice.info",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventice.nl",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventice.site",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventicemail.biz",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventicemail.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventices.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventiceservices.net",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventiceservices.org",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventicesolutions.biz",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventicesolutions.info",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventicetest2.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "polymerics.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "feacegif.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "feacfslf.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "driverdirectphysicals.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "geneseeorthopedics.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "cliniqueveterinairedesoultz.fr",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "cliniqueveterinaireleshoublonnieres.fr",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "nic.fox",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "dormakaba.kz",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "bowlatparadise.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "sanfernandovalleylawyers.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "usfraudattorneys.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "nostalgicmotoringltd.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventice.biz",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "buyyoutubevideos.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "sjclassics.net",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
}
]
}
No Historical Data Available
Website change history data is not available for this domain.
No Subdomains Discovered
No subdomains were found for this domain
This could indicate a simple site structure or restricted enumeration
2
IP Changes
2
Unique IPs
2
Locations
IP Address History Timeline:
184.106.72.57
Detected:
Feb 14, 2019
Location:
United States
Record ID: #38215374
Timestamp:
02/14/2019 11:43
34.213.106.51
Detected:
Oct 24, 2025
Location:
Argentina
Record ID: #39358376
Timestamp:
10/24/2025 13:50
No Related Sites Found
No related websites were discovered for this domain
This indicates an isolated or independent web presence
204
Possibly Related
204
Active Sites
0
Subdomains
Possibly Related Domains:
| Domain | Relationship | Status | Trust Score | Location | Action |
|---|---|---|---|---|---|
| Shared Server | Active | N/A | 🇦🇺 Australia | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇸🇬 Singapore | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇸🇪 Sweden | ||
| Shared Server | Active | N/A | 🇩🇪 Germany | ||
| Shared Server | Active | N/A | 🇩🇪 Germany | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇩🇪 Germany | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇩🇪 Germany | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇮🇪 Ireland | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇧🇪 Belgium | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇰🇪 Kenya | ||
| Shared Server | Active | N/A | 🇸🇪 Sweden | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇫🇷 France | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇩🇪 Germany | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇩🇪 Germany | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇪🇸 Spain | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇩🇪 Germany | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇸🇪 Sweden | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown |
Page of
Page of
{
"subDomains": [],
"ipHistories": [
{
"id": "38215374",
"ip": "184.106.72.57",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"countryCode": "US",
"detectedDate": "",
"createTimestamp": "2019-02-14 11:43:13",
"period": "Feb 14, 2019",
"dateRange": "Feb 14, 2019",
"current": false
},
{
"id": "39358376",
"ip": "34.213.106.51",
"country": {
"code": "Ar",
"name": "Argentina",
"flag": "\ud83c\udde6\ud83c\uddf7"
},
"countryCode": "Ar",
"detectedDate": "2025-10-24 13:50:39",
"createTimestamp": "2025-10-24 13:50:39",
"period": "Oct 24, 2025",
"dateRange": "Oct 24, 2025",
"current": false
}
],
"relatedSites": [],
"totalSubdomains": 0,
"totalIpChanges": 2,
"totalRelatedSites": 0
}
Need programmatic access to this domain analysis data?
Data copied to clipboard!