Is worldvision.org a Scam or Legit?
Protect yourself from scams with our advanced website reputation checker.
Highly Trusted
| Feature | Simple | Pro |
|---|---|---|
| Trust Score & Verdict | ||
| Basic Domain Info | ||
| Technical Analysis | ||
| Historical Data & Timeline | ||
| Interactive Location Map | ||
| Charts & Visualizations |
Both modes show the same trust analysis, Pro mode adds technical details for advanced users
Why We Scored It 100/100
AI Website Analysis
worldvision.org looks like a legit website. If you disagree with this review, then by all means add your own and let your voice be heard!
worldvision.org Preview
Give gifts that grow | World Vision
Help hope flourish this Christmas by giving gifts that grow in impact and help kids and families thrive past the holiday season!
Website Reputation
Domain Age
29 Years, 202 Days
Website Likely From
United States
Highly Trusted
Security Analysis
SSL Certificate
Unknown
Firewall Protection
Not Protected
External Scans
Clean
Related to other Risky Websites
No
50% security standards met
Reviews & Ratings
Facebook (6 reviews)
4 years ago
WebofTrust (4 reviews)
4 years ago
AI-Powered Insights
Overall Text Sentiment Analysis
Based on written review content
Community Discussion
Join the conversation! Share your experience with worldvision.org and help others make informed decisions
FAQs
Common questions about worldvision.org website security analysis
Is worldvision.org safe to use?
Based on our comprehensive analysis, worldvision.org appears to be safe. Our security assessment gave it a trust score of 100/100.
Key factors analyzed:
- • SSL certificate validation and security
- • Domain age and registration details
- • Hosting location and infrastructure
- • Community reviews and reputation data
- • Blacklist checking across security databases
What do the trust scores mean?
Our trust scores range from 0-100 and indicate the overall safety and legitimacy of a website:
How accurate is this security analysis?
Our analysis combines multiple authoritative data sources and uses advanced algorithms to provide highly accurate assessments. However, no automated system is 100% perfect.
We recommend:
- • Using our analysis as one factor in your decision
- • Checking multiple review sources for important transactions
- • Trusting your instincts if something feels wrong
- • Being extra cautious with financial or personal information
What should I do if I encounter a scam website?
If you've encountered a scam website, take these immediate steps:
Immediate Actions:
- • Do not provide any personal or financial information
- • Close the website immediately
- • Run antivirus scan if you downloaded anything
- • Change passwords if you entered any credentials
Report the Scam:
- • Report to FTC at reportfraud.ftc.gov
- • Report to your local authorities
- • Submit a review on our platform to warn others
- • Share warnings with friends and family
Why does worldvision.org have this trust rating?
The trust rating for worldvision.org is based on multiple security and reputation factors:
Positive Factors:
- • Positive community feedback
- • No security warnings detected
Risk Factors:
- • No significant risks detected
Share this analysis
Highly Trusted
| Feature | Simple | Pro |
|---|---|---|
| Trust Score & Verdict | ||
| Basic Domain Info | ||
| Technical Analysis | ||
| Historical Data & Timeline | ||
| Interactive Location Map | ||
| Charts & Visualizations |
Both modes show the same trust analysis, Pro mode adds technical details for advanced users
AI Website Analysis
worldvision.org looks like a legit website. If you disagree with this review, then by all means add your own and let your voice be heard!
worldvision.org Preview
Give gifts that grow | World Vision
Help hope flourish this Christmas by giving gifts that grow in impact and help kids and families thrive past the holiday season!
Site Information
Key Statistics
Geographic Information
Business Contact Details
{
"domain": null,
"title": "Give gifts that grow | World Vision",
"description": "Help hope flourish this Christmas by giving gifts that grow in impact and help kids and families thrive past the holiday season!",
"age": "29 Years, 202 Days",
"value": "$453.1K",
"country": "United States",
"coordinates": null,
"lastChecked": "2022-08-26T22:03:00.000000Z",
"categories": null
}
Risk Indicators
2Scam Keywords
Sign up to view
No Firewall Protection
Trust Indicators
3Good Global Rank
Sign up to view
Good Reviews
Strong Social Media
SSL & Certificates
{
"securityInfo": {
"hideSection": false,
"sslValid": [],
"sslName": "",
"sslValidFrom": [],
"sslValidFromDaysAgo": [],
"sslValidTo": [],
"sslValidToDaysLeft": [],
"redirectsToHTTPS": [],
"hasBadReviews": {
"type": "info",
"text": "No",
"origBValue": false,
"origSValue": "No",
"origNValue": null,
"origDValue": null
},
"relatedToOtherNotTrustedSites": {
"type": "info",
"text": "No",
"origBValue": false,
"origSValue": "No",
"origNValue": null,
"origDValue": null
},
"theirServerIpIsMarkedAsAbusive": {
"type": "info",
"text": "No",
"origBValue": false,
"origSValue": "No",
"origNValue": null,
"origDValue": null
},
"hackedOrBeenHacked": {
"type": "info",
"text": "No",
"origBValue": false,
"origSValue": "No",
"origNValue": null,
"origDValue": null
},
"firewallFound": {
"type": "info",
"text": "Not Protected",
"origBValue": false,
"origSValue": "Not Protected",
"origNValue": null,
"origDValue": null
},
"markedAsRisk": {
"type": "info",
"text": "No",
"origBValue": false,
"origSValue": "No",
"origNValue": null,
"origDValue": null
},
"siteAdult": {
"type": "info",
"text": "No",
"origBValue": false,
"origSValue": "No",
"origNValue": null,
"origDValue": null
},
"nastyTags": [],
"securityBadges": []
},
"sslInfo": [],
"firewall": "",
"blacklistStatus": [],
"externalScans": []
}
Rankings & Traffic
{
"trustedRank": "Low Rating",
"siteVisitors": "Busy",
"globalRank": "8862",
"pageRank": 5.48,
"googlebotvisit": "May 11, 2016 05:35:53 GMT. </div",
"googleindexed": "0",
"bingindexed": "0",
"yahooindexed": "0",
"yahoodir": "1",
"googlebacklinks": "1",
"yahoobacklinks": "0",
"validrank": "0",
"siteSpeed": "Very Fast",
"numPageViews": 0,
"webPresenceInfo": {
"socialMedia": {
"twitter": null,
"facebook": null,
"linkedin": null,
"instagram": null
},
"businessListings": [],
"newsReferences": []
},
"previousRank": [
{
"id": "191002",
"globalrank": "8862",
"opr_globalrank": "12992",
"opr_pagerank": "5",
"tldrank": "981",
"domain": "worldvision.org",
"tld": null,
"refsubnets": "4801",
"refips": "8010",
"idn_domain": "worldvision.org",
"idn_tld": "org",
"prevglobalrank": "8843",
"prevtldrank": "975",
"prevrefsubnets": "4812",
"prevrefips": "7980",
"create_update_timestamp": "2025-10-28 19:46:33"
},
{
"id": "43282",
"globalrank": "6723",
"opr_globalrank": "13743",
"opr_pagerank": "6",
"tldrank": "760",
"domain": "worldvision.org",
"tld": null,
"refsubnets": "7334",
"refips": "11282",
"idn_domain": "worldvision.org",
"idn_tld": "org",
"prevglobalrank": "6738",
"prevtldrank": "760",
"prevrefsubnets": "7328",
"prevrefips": "11341",
"create_update_timestamp": "2022-08-26 22:03:36"
}
],
"previousRank_count": 2
}
Global Sentiment Metrics Sentiment Metrics
Keywords Analysis
| Keyword | Frequency | Classification |
|---|---|---|
| SCAM |
1
|
Negative |
Per-Source Sentiment Analysis
WebofTrust
{
"global": {
"avgSentCom": null,
"avgSentNeg": null,
"avgSentNeu": null,
"avgSentPos": null,
"numBad": 0,
"numGood": 0,
"badPerc": 0,
"goodPerc": 0,
"sentimentAnalyzedTotal": 0,
"totalReviews": 10,
"ratingPerc": 0
},
"reviews": [
{
"name": "Facebook",
"sentiment": 0,
"stars": 4,
"review_total": 6,
"keyword": [],
"keyword_count": [],
"word": [],
"word_count": []
},
{
"name": "WebofTrust",
"sentiment": 0.02485,
"stars": 4.3,
"review_total": 4,
"keyword": [
"SCAM"
],
"keyword_count": [
"1"
],
"word": [
"humanitarian",
"informative",
"worldwide",
"world",
"vision",
"tackling",
"poverty",
"potential",
"organization",
"injustice"
],
"word_count": [
"1",
"1",
"1",
"1",
"1",
"1",
"1",
"1",
"1",
"1"
]
}
],
"keywords": [
{
"keyword": "SCAM",
"set_flag": "flag_scam_keyword",
"type": "F",
"good_bad": "B",
"total": "1"
}
],
"wordFrequency": [
{
"word": "charity",
"total": "1"
},
{
"word": "children",
"total": "1"
},
{
"word": "christian",
"total": "1"
},
{
"word": "communities",
"total": "1"
},
{
"word": "dedicated",
"total": "1"
},
{
"word": "donors",
"total": "1"
},
{
"word": "fairs",
"total": "1"
},
{
"word": "families",
"total": "1"
},
{
"word": "humanitarian",
"total": "1"
},
{
"word": "informative",
"total": "1"
}
],
"benford": {
"totalReviews": "0",
"ratingPerc": null,
"numBad": null,
"numGood": null,
"avgSentCom": null,
"avgSentNeg": null,
"avgSentNeu": null,
"avgSentPos": null,
"0": {
"digit": "1",
"total": "2",
"perc": "50.0000",
"base": 30.1
},
"1": {
"digit": "2",
"total": "1",
"perc": "25.0000",
"base": 17.6
},
"2": {
"digit": "3",
"total": "1",
"perc": "25.0000",
"base": 12.5
}
},
"actualTotals": {
"totalReviews": 10,
"averageRating": 4.12,
"sources": {
"Facebook": 6,
"WebofTrust": 4
},
"starDistribution": {
"5": 4,
"4": 4,
"3": 1,
"2": 1,
"1": 0,
"0": 0
}
}
}
Domain Details
Domain Registrar
Domain WHOIS Information
Privacy Protection Notice
Most modern domain registrations use privacy protection services. Contact details may be redacted or replaced with privacy service information to protect registrant identity.
Domain's Name Servers 8 servers
| Domain | IP Address | Country | ISP | City | Postal Code |
|---|---|---|---|---|---|
| dns32.cloudns.net | 185.136.97.100 |
United Kingdom
|
Cloud DNS Ltd | London | W1B |
| dns33.cloudns.net | 185.136.98.100 |
United Kingdom
|
Cloud DNS Ltd | London | W1B |
| dns4.p01.nsone.net | 198.51.45.65 |
United States
|
NSONE Inc | Kimball | 69145 |
| dns34.cloudns.net | 185.136.99.100 |
United Kingdom
|
Cloud DNS Ltd | London | W1B |
| dns1.p01.nsone.net | 198.51.44.1 |
United States
|
NSONE Inc | Toronto | 43964 |
| dns2.p01.nsone.net | 198.51.45.1 |
United States
|
NSONE Inc | Kimball | 69145 |
| dns3.p01.nsone.net | 198.51.44.65 |
United States
|
NSONE Inc | Toronto | 43964 |
| dns31.cloudns.net | 185.136.96.100 |
United Kingdom
|
Cloud DNS Ltd | London | W1B |
| Domain | IP Address | Country | ISP | City | Postal Code |
|---|---|---|---|---|---|
|
dns32.cloudns.net
|
185.136.97.100 |
United Kingdom
|
Cloud DNS Ltd
|
London | W1B |
|
dns33.cloudns.net
|
185.136.98.100 |
United Kingdom
|
Cloud DNS Ltd
|
London | W1B |
|
dns4.p01.nsone.net
|
198.51.45.65 |
United States
|
NSONE Inc
|
Kimball | 69145 |
|
dns34.cloudns.net
|
185.136.99.100 |
United Kingdom
|
Cloud DNS Ltd
|
London | W1B |
|
dns1.p01.nsone.net
|
198.51.44.1 |
United States
|
NSONE Inc
|
Toronto | 43964 |
|
dns2.p01.nsone.net
|
198.51.45.1 |
United States
|
NSONE Inc
|
Kimball | 69145 |
|
dns3.p01.nsone.net
|
198.51.44.65 |
United States
|
NSONE Inc
|
Toronto | 43964 |
|
dns31.cloudns.net
|
185.136.96.100 |
United Kingdom
|
Cloud DNS Ltd
|
London | W1B |
{
"domainNameInfo": {
"hideSection": false,
"registrarName": "Domain.com - Network Solutions, LLC",
"registrarCountry": null,
"registrarEmail": "[email protected]",
"registrarUrl": "",
"registrarWhoIs": "",
"age": "29 Years, 202 Days",
"createdDate": "1996-04-10T04:00:00.000000Z",
"expirationDate": "2030-04-11T04:00:00.000000Z",
"lastModifiedDate": "2025-06-24T23:07:33.000000Z",
"owner": {
"name": "",
"organization": "",
"email": "[email protected]",
"phone": "+1.8777228662",
"fax": "",
"street": "",
"city": "",
"state": "",
"postalCode": "",
"country": null
},
"admin": {
"name": "",
"organization": "",
"email": "[email protected]",
"phone": "+1.8777228662",
"fax": "",
"street": "",
"city": "",
"state": "",
"postalCode": "",
"country": null
},
"technical": {
"name": "",
"organization": "",
"email": "[email protected]",
"phone": "+1.8777228662",
"fax": "",
"street": "",
"city": "",
"state": "",
"postalCode": "",
"country": null
},
"billing": null,
"whoisDataAge": "-1"
},
"registrar": {
"name": "Domain.com - Network Solutions, LLC",
"country": "CA",
"ip": "104.18.42.197",
"whois": "whois.domain.com",
"home": "domain.com"
},
"contacts": {
"owner": {
"name": "",
"org": "",
"country": "",
"email": "[email protected]"
},
"admin": {
"name": "",
"org": "",
"country": "",
"email": "[email protected]"
},
"technical": {
"name": "",
"org": "",
"country": "",
"email": "[email protected]"
}
},
"nameServers": [
{
"name": "dns32.cloudns.net",
"ip": "185.136.97.100",
"country": {
"code": "gb",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
},
"type": "NS",
"city": "London",
"region": "",
"postcode": "W1B",
"isp": "Cloud DNS Ltd",
"latitude": "51.5072",
"longitude": "-0.127586"
},
{
"name": "dns33.cloudns.net",
"ip": "185.136.98.100",
"country": {
"code": "gb",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
},
"type": "NS",
"city": "London",
"region": "",
"postcode": "W1B",
"isp": "Cloud DNS Ltd",
"latitude": "51.5072",
"longitude": "-0.127586"
},
{
"name": "dns4.p01.nsone.net",
"ip": "198.51.45.65",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"type": "NS",
"city": "Kimball",
"region": "",
"postcode": "69145",
"isp": "NSONE Inc",
"latitude": "41.2357",
"longitude": "-103.663"
},
{
"name": "dns34.cloudns.net",
"ip": "185.136.99.100",
"country": {
"code": "gb",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
},
"type": "NS",
"city": "London",
"region": "",
"postcode": "W1B",
"isp": "Cloud DNS Ltd",
"latitude": "51.5072",
"longitude": "-0.127586"
},
{
"name": "dns1.p01.nsone.net",
"ip": "198.51.44.1",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"type": "NS",
"city": "Toronto",
"region": "",
"postcode": "43964",
"isp": "NSONE Inc",
"latitude": "40.4642",
"longitude": "-80.6009"
},
{
"name": "dns2.p01.nsone.net",
"ip": "198.51.45.1",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"type": "NS",
"city": "Kimball",
"region": "",
"postcode": "69145",
"isp": "NSONE Inc",
"latitude": "41.2357",
"longitude": "-103.663"
},
{
"name": "dns3.p01.nsone.net",
"ip": "198.51.44.65",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"type": "NS",
"city": "Toronto",
"region": "",
"postcode": "43964",
"isp": "NSONE Inc",
"latitude": "40.4642",
"longitude": "-80.6009"
},
{
"name": "dns31.cloudns.net",
"ip": "185.136.96.100",
"country": {
"code": "gb",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
},
"type": "NS",
"city": "London",
"region": "",
"postcode": "W1B",
"isp": "Cloud DNS Ltd",
"latitude": "51.5072",
"longitude": "-0.127586"
}
],
"dates": {
"created": "1996-04-10T04:00:00.000000Z",
"expires": "2030-04-11T04:00:00.000000Z",
"modified": "2025-06-24T23:07:33.000000Z"
}
}
Event Categories
Domain & Core
Social & Reviews
Technical Events
Interactive Timeline
Domain Created
April 10, 1996
DomainFirst Subdomain
April 10, 1996
TechnicalTwitter/X Joined
January 5, 2008
SocialFirst Review
September 21, 2009
SocialLatest Review
June 14, 2014
SocialFirst Analyzed
April 7, 2025
TechnicalHosting Provider
Server Information
Shared Hosting Analysis 156 shared sites
Websites that have the same IP address as WORLDVISION.ORG
Australia
United States
United States
United States
Singapore
United States
United States
United States
United States
United States
United States
United States
United Kingdom
United States
United States
United States
United States
United States
United States
Sweden
Canada
United States
United States
United States
United States
United States
United States
United States
United States
United States
Ireland
United States
United States
United States
United States
United States
United States
United States
United States
Belgium
Canada
United States
Canada
United States
United States
Kenya
Sweden
United States
United States
United Kingdom
United States
United States
United States
Canada
United States
Canada
Canada
United States
Canada
Canada
Canada
Germany
United Kingdom
United States
United Kingdom
United States
France
United States
United States
United States
United Kingdom
United States
Canada
United States
United States
United States
United States
United States
United States
United States
United States
United States
United States
Canada
United States
Canada
Canada
United States
United States
United States
United States
United States
Network Infrastructure
Performance Metrics
{
"hostingInfo": {
"hideSection": false,
"internetServiceProvider": "Unknown",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"mostLikelyServerIp": "13.248.160.137",
"serverLocation": "United States",
"hostingProvider": "EasyRedir",
"asn": "",
"organizationName": "",
"serverOS": "",
"type": ""
},
"ip": "13.248.160.137",
"server": "EasyRedir",
"netOrg": "Unknown",
"ipcountry": "us",
"firewall": "",
"registrar": "Domain.com - Network Solutions, LLC",
"registrarCountry": "CA",
"sharedIpSites": [
{
"domain": "harrispestmackay.com.au",
"rating": "1",
"country": {
"code": "AU",
"name": "Australia",
"flag": "\ud83c\udde6\ud83c\uddfa"
}
},
{
"domain": "branch.com",
"rating": "63",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "athenasoftware.net",
"rating": "93",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "portal.onewire.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "esilicon.com",
"rating": "98",
"country": {
"code": "SG",
"name": "Singapore",
"flag": "\ud83c\uddf8\ud83c\uddec"
}
},
{
"domain": "corvettesandmusclecars.com",
"rating": "99",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "rochesterregionalhealth.org",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "tads.com",
"rating": "109",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "wella.co.uk",
"rating": "110",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "swobodapestcontrol.com",
"rating": "85",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "janssen-deutschland.de",
"rating": "7",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "boohoo.fr",
"rating": "27",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "finance.debenhams.com",
"rating": "41",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "pullsdirect.com",
"rating": "42",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "airceldryers.com",
"rating": "46",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "polyscienceculinary.com",
"rating": "49",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "pjsautoworld.com",
"rating": "50",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "foacommercial.com",
"rating": "50",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "channelnewsasia.tv",
"rating": "50",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "ryah.ca",
"rating": "50",
"country": {
"code": "SE",
"name": "Sweden",
"flag": "\ud83c\uddf8\ud83c\uddea"
}
},
{
"domain": "prosperityws.com",
"rating": "50",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "hopkinsfirm.com",
"rating": "52",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "beachbodycert.com",
"rating": "62",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "gerarddonderolaw.com",
"rating": "64",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "the3dgift.com",
"rating": "66",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "emerson-academy.org",
"rating": "70",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "vistacharteracademy.org",
"rating": "70",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "burton.co.uk",
"rating": "81",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "parkerhill.org",
"rating": "83",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "evolveclothing.com",
"rating": "83",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "campingworld.co.uk",
"rating": "84",
"country": {
"code": "IE",
"name": "Ireland",
"flag": "\ud83c\uddee\ud83c\uddea"
}
},
{
"domain": "absolutepest.com",
"rating": "84",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "winecoolerdirect.com",
"rating": "86",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "expresspipe.reece.com",
"rating": "86",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "grandriveracademy.org",
"rating": "86",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "cortina-systems.com",
"rating": "90",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "inphi.com",
"rating": "90",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "allegra-fs.co.uk",
"rating": "90",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "patientwise.com",
"rating": "92",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "order.acuvue.it",
"rating": "92",
"country": {
"code": "BE",
"name": "Belgium",
"flag": "\ud83c\udde7\ud83c\uddea"
}
},
{
"domain": "preventicesolutions.info",
"rating": "93",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "beachbody.co.uk",
"rating": "94",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "donofriolawoffice.com",
"rating": "94",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "millikenchemical.com",
"rating": "94",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "gnash.us",
"rating": "94",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "builders.co.ke",
"rating": "94",
"country": {
"code": "KE",
"name": "Kenya",
"flag": "\ud83c\uddf0\ud83c\uddea"
}
},
{
"domain": "cliniqueveterinairelapepiniere.fr",
"rating": "94",
"country": {
"code": "SE",
"name": "Sweden",
"flag": "\ud83c\uddf8\ud83c\uddea"
}
},
{
"domain": "bodybeast.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "collegesugarbabes.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "trutex.com",
"rating": "95",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "preventice.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "hardandalone.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "preventice.us",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "dorma-kaba.se",
"rating": "95",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "wpcomics.washingtonpost.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "order.acuvue.dk",
"rating": "95",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "conseillers.investia.ca",
"rating": "95",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "eternitydiamonds.us",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "preventicegc.com",
"rating": "95",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "preventicesolution.com",
"rating": "95",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "preventicetechnologies.com",
"rating": "95",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "wearencs.com",
"rating": "95",
"country": {
"code": "DE",
"name": "Germany",
"flag": "\ud83c\udde9\ud83c\uddea"
}
},
{
"domain": "bca.dk",
"rating": "95",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "slimin6.com",
"rating": "96",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "cvvillas.com",
"rating": "96",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "hazardscyclesport.com",
"rating": "96",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "quill-offers.com",
"rating": "96",
"country": {
"code": "FR",
"name": "France",
"flag": "\ud83c\uddeb\ud83c\uddf7"
}
},
{
"domain": "betterknowaballot.com",
"rating": "96",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "tastethefloorrecords.com",
"rating": "96",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "thinkministry.com",
"rating": "96",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "elizabeth-rose.com",
"rating": "97",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "preventice.cloud",
"rating": "97",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "preventicetest.com",
"rating": "97",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "cdx.bostonscientific.com",
"rating": "97",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "onvia.com",
"rating": "98",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "tiesto.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "myfriendshotmom.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "Jnj.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "waylandgames.co.uk",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "dv8fashion.co.uk",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "bostonscientific.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "gimbal.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "cnanews.sg",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "mybodyguardian.com",
"rating": "100",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "prevent1ce.us",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "preventicetechnologies.info",
"rating": "100",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "meanwell-packaging.co.uk",
"rating": "100",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "build.acl.com",
"rating": "105",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "boohoo.co.uk",
"rating": "65",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "datapointeurope.com",
"rating": "105",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "dierenkliniekhattemwapenveld.nl",
"rating": "107",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "northrocklanes.com",
"rating": "108",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "mta-sts.mail.dorma-glas.de",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "vela.law",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "processingpros.shop",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "ustapr.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "franchise.leesfamousrecipe.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "sales-lentz.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "interactivedatascience.org",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "techastra.statefarm.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "7z9aij8x.edge.easyredir.net",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "surveyresults.sallinggroup.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "revanceu.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "thescoutsshop.com.au",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "mclainmilitarylawyer.com.cdn.cloudflare.net",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "elektramusicgroup.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "clappmoroney.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "scottadamssays.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "cpanel.aerationsplusla.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "waterwisela.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "webdisk.aerationsplusla.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "webdisk.waterwisela.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "hello.digital22.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "video.digital22.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "botsy.app",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "absolutlaw.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "taylorprep.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "abogadosdeaccidenteslosangeles.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "hardlinepest.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "neumannlawyers.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "caplansjewelry.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "profound-france.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "tegnamarketingsolutions.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "bodyguardian.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "boostclinical.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "boostis.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "infosensor.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "prevent1ce.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "prevent1ce.info",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventice.eu",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventice.info",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventice.nl",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventice.site",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventicemail.biz",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventicemail.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventices.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventiceservices.net",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventiceservices.org",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventicesolutions.biz",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventicetest2.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "polymerics.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "feacegif.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "feacfslf.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "driverdirectphysicals.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "geneseeorthopedics.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "cliniqueveterinairedesoultz.fr",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "cliniqueveterinaireleshoublonnieres.fr",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "nic.fox",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "dormakaba.kz",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "bowlatparadise.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "sanfernandovalleylawyers.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "usfraudattorneys.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "nostalgicmotoringltd.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventice.biz",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "buyyoutubevideos.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "sjclassics.net",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
}
]
}
No Historical Data Available
Website change history data is not available for this domain.
Discovered Subdomains:
| Subdomain | Country | Trust Rating | IP Address |
|---|---|---|---|
|
donate.worldvision.org
Created: Apr 10, 1996
|
United States
|
Low Risk Site | 72.21.92.199 |
|
support.worldvision.org
Created: Apr 10, 1996
|
United States
|
Low Risk Site | 69.48.252.146 |
|
pages.newsletter.worldvision.org
Created: Apr 10, 1996
|
United States
|
Low Risk Site | 66.231.91.161 |
|
churchresources.worldvision.org
Created: Apr 10, 1996
|
United States
|
Low Risk Site | 204.93.213.54 |
|
news.worldvision.org
Created: Apr 10, 1996
|
United States
|
Low Risk Site | 206.132.3.45 |
|
m.worldvision.org
Created: Apr 10, 1996
|
United States
|
Low Risk Site | 192.124.249.6 |
|
magazine.worldvision.org
Created: Apr 10, 1996
|
United States
|
Low Risk Site | 52.22.215.1 |
|
mycause.worldvision.org
Created: Apr 10, 1996
|
United States
|
Low Risk Site | 64.154.105.165 |
IP Address History Timeline:
No Related Sites Found
No related websites were discovered for this domain
This indicates an isolated or independent web presence
Possibly Related Domains:
| Domain | Relationship | Status | Trust Score | Location | Action |
|---|---|---|---|---|---|
| Subdomain | Active | 100 | 🇺🇸 United States | ||
| Subdomain | Active | 100 | 🇺🇸 United States | ||
| Subdomain | Active | 110 | 🇺🇸 United States | ||
| Subdomain | Active | 100 | 🇺🇸 United States | ||
| Subdomain | Active | 108 | 🇺🇸 United States | ||
| Subdomain | Active | 100 | 🇺🇸 United States | ||
| Subdomain | Active | 95 | 🇺🇸 United States | ||
| Subdomain | Active | 109 | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇦🇺 Australia | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇸🇬 Singapore | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇸🇪 Sweden | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇮🇪 Ireland | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇧🇪 Belgium | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇰🇪 Kenya | ||
| Shared Server | Active | N/A | 🇸🇪 Sweden | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇩🇪 Germany | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇫🇷 France | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown |
{
"subDomains": [
{
"subdomain": "donate.worldvision.org",
"name": "donate.worldvision.org",
"ip": "72.21.92.199",
"active": true,
"status": "active",
"rating": "100",
"trustScore": "100",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"ipcountry": "us",
"likelyCountry": "us",
"discovered": "1996-04-10 04:00:00",
"lastChecked": "1996-04-10 04:00:00",
"title": "",
"description": ""
},
{
"subdomain": "support.worldvision.org",
"name": "support.worldvision.org",
"ip": "69.48.252.146",
"active": true,
"status": "active",
"rating": "100",
"trustScore": "100",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"ipcountry": "us",
"likelyCountry": "us",
"discovered": "1996-04-10 04:00:00",
"lastChecked": "1996-04-10 04:00:00",
"title": "",
"description": ""
},
{
"subdomain": "pages.newsletter.worldvision.org",
"name": "pages.newsletter.worldvision.org",
"ip": "66.231.91.161",
"active": true,
"status": "active",
"rating": "110",
"trustScore": "110",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"ipcountry": "us",
"likelyCountry": "",
"discovered": "1996-04-10 05:00:00",
"lastChecked": "1996-04-10 05:00:00",
"title": "",
"description": ""
},
{
"subdomain": "churchresources.worldvision.org",
"name": "churchresources.worldvision.org",
"ip": "204.93.213.54",
"active": true,
"status": "active",
"rating": "100",
"trustScore": "100",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"ipcountry": "us",
"likelyCountry": "us",
"discovered": "1996-04-10 04:00:00",
"lastChecked": "1996-04-10 04:00:00",
"title": "",
"description": ""
},
{
"subdomain": "news.worldvision.org",
"name": "news.worldvision.org",
"ip": "206.132.3.45",
"active": true,
"status": "active",
"rating": "108",
"trustScore": "108",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"ipcountry": "us",
"likelyCountry": "",
"discovered": "1996-04-10 05:00:00",
"lastChecked": "1996-04-10 05:00:00",
"title": "",
"description": ""
},
{
"subdomain": "m.worldvision.org",
"name": "m.worldvision.org",
"ip": "192.124.249.6",
"active": true,
"status": "active",
"rating": "100",
"trustScore": "100",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"ipcountry": "us",
"likelyCountry": "us",
"discovered": "1996-04-10 05:00:00",
"lastChecked": "1996-04-10 05:00:00",
"title": "",
"description": ""
},
{
"subdomain": "magazine.worldvision.org",
"name": "magazine.worldvision.org",
"ip": "52.22.215.1",
"active": true,
"status": "active",
"rating": "95",
"trustScore": "95",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"ipcountry": "us",
"likelyCountry": "us",
"discovered": "1996-04-10 05:00:00",
"lastChecked": "1996-04-10 05:00:00",
"title": "",
"description": ""
},
{
"subdomain": "mycause.worldvision.org",
"name": "mycause.worldvision.org",
"ip": "64.154.105.165",
"active": true,
"status": "active",
"rating": "109",
"trustScore": "109",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"ipcountry": "us",
"likelyCountry": "",
"discovered": "1996-04-10 05:00:00",
"lastChecked": "1996-04-10 05:00:00",
"title": "",
"description": ""
}
],
"ipHistories": [
{
"id": "58360",
"ip": "67.129.98.22",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"countryCode": "US",
"detectedDate": "",
"createTimestamp": "2016-04-22 16:05:42",
"period": "Apr 22, 2016",
"dateRange": "Apr 22, 2016",
"current": false
}
],
"relatedSites": [],
"totalSubdomains": 8,
"totalIpChanges": 1,
"totalRelatedSites": 0
}
Need programmatic access to this domain analysis data?