Advertisement
Google Ads
160 x 600
Advertisement
Google Ads
160 x 600
Advertisement
Google Ads
160 x 600
Advertisement
Google Ads
160 x 600
ScamOrLegit
Basic Pro

Is cekverifikasipengirimanpesanan.ezyro.com a Scam or Legit?

Protect yourself from scams with our advanced website reputation checker.

Stay Protected with ScamOrLegit.ai

Get weekly updates on the latest scam trends and security tips to keep you safe online.

YouTube 14K Follow @ScamOrLegitHQ

For Consumers

  • Report a Scam
  • How to Get Your Money Back
  • How to Recognize a Scam Website
  • Check a site for me

For Businesses

  • Claim your Website
  • API & Data Feed
  • Install Our Logo
  • Advertise on ScamOrLegit

About ScamOrLegit

  • About Us
  • FAQ
  • In the Press
  • Contact

Help & Resources

  • Where to Report Fraud

ScamOrLegit.ai

Protecting consumers from online fraud through advanced domain analysis and community-driven trust scoring.

Privacy Policy | Terms & Conditions | Disclaimer | Content Guidelines | Sitemap | Recent checks | Recent Suspicious

Copyright © 2025 ScamOrLegit.ai. All rights reserved.

Analyzing domain...

This may take a moment for new domains...

Stopping analysis...
Analysis complete!
Connecting to domain...
Checking security certificates...
Analyzing reputation data...
Gathering user reviews...

This usually takes 5-15 seconds