Is hardandalone.com a Scam or Legit?
Protect yourself from scams with our advanced website reputation checker.
Highly Trusted
| Feature | Simple | Pro |
|---|---|---|
| Trust Score & Verdict | ||
| Basic Domain Info | ||
| Technical Analysis | ||
| Historical Data & Timeline | ||
| Interactive Location Map | ||
| Charts & Visualizations |
Both modes show the same trust analysis, Pro mode adds technical details for advanced users
Why We Scored It 95/100
AI Website Analysis
hardandalone.com looks like a legit website. Please be aware that the last time we checked this website is redirecting/forwarding to another website called richard.xxx.You may wish to check the rating of that site by clicking here [check]Please be aware hardandalone.com appears to have adult content. Help us by adding your review and informing others about your experience!
hardandalone.com Preview
Richard XXX
Website Reputation
Domain Age
13 Years, 41 Days
Website Likely From
United States
Highly Trusted
Security Analysis
SSL Certificate
Unknown
Firewall Protection
Yes
External Scans
Clean
Related to other Risky Websites
No
75% security standards met
Community Discussion
Join the conversation! Share your experience with hardandalone.com and help others make informed decisions
FAQs
Common questions about hardandalone.com website security analysis
Is hardandalone.com safe to use?
Based on our comprehensive analysis, hardandalone.com appears to be safe. Our security assessment gave it a trust score of 95/100.
Key factors analyzed:
- • SSL certificate validation and security
- • Domain age and registration details
- • Hosting location and infrastructure
- • Community reviews and reputation data
- • Blacklist checking across security databases
What do the trust scores mean?
Our trust scores range from 0-100 and indicate the overall safety and legitimacy of a website:
How accurate is this security analysis?
Our analysis combines multiple authoritative data sources and uses advanced algorithms to provide highly accurate assessments. However, no automated system is 100% perfect.
We recommend:
- • Using our analysis as one factor in your decision
- • Checking multiple review sources for important transactions
- • Trusting your instincts if something feels wrong
- • Being extra cautious with financial or personal information
What should I do if I encounter a scam website?
If you've encountered a scam website, take these immediate steps:
Immediate Actions:
- • Do not provide any personal or financial information
- • Close the website immediately
- • Run antivirus scan if you downloaded anything
- • Change passwords if you entered any credentials
Report the Scam:
- • Report to FTC at reportfraud.ftc.gov
- • Report to your local authorities
- • Submit a review on our platform to warn others
- • Share warnings with friends and family
Why does hardandalone.com have this trust rating?
The trust rating for hardandalone.com is based on multiple security and reputation factors:
Positive Factors:
- • Positive community feedback
- • No security warnings detected
Risk Factors:
- • No significant risks detected
Share this analysis
Highly Trusted
| Feature | Simple | Pro |
|---|---|---|
| Trust Score & Verdict | ||
| Basic Domain Info | ||
| Technical Analysis | ||
| Historical Data & Timeline | ||
| Interactive Location Map | ||
| Charts & Visualizations |
Both modes show the same trust analysis, Pro mode adds technical details for advanced users
AI Website Analysis
hardandalone.com looks like a legit website. Please be aware that the last time we checked this website is redirecting/forwarding to another website called richard.xxx.You may wish to check the rating of that site by clicking here [check]Please be aware hardandalone.com appears to have adult content. Help us by adding your review and informing others about your experience!
hardandalone.com Preview
Richard XXX
Site Information
Key Statistics
Geographic Information
{
"domain": null,
"title": "Richard XXX",
"description": "",
"age": "13 Years, 41 Days",
"value": "",
"country": "United States",
"coordinates": "45.8399, -119.701",
"lastChecked": "2025-10-23T01:35:00.000000Z",
"categories": null
}
Risk Indicators
3Sign up to view
Low Traffic
No Reviews
No Social Media Detected
Trust Indicators
1Sign up to view
Protected by Firewall
SSL & Certificates
{
"securityInfo": {
"hideSection": false,
"sslValid": [],
"sslName": "",
"sslValidFrom": [],
"sslValidFromDaysAgo": [],
"sslValidTo": [],
"sslValidToDaysLeft": [],
"redirectsToHTTPS": [],
"hasBadReviews": {
"type": "info",
"text": "No",
"origBValue": false,
"origSValue": "No",
"origNValue": null,
"origDValue": null
},
"relatedToOtherNotTrustedSites": {
"type": "info",
"text": "No",
"origBValue": false,
"origSValue": "No",
"origNValue": null,
"origDValue": null
},
"theirServerIpIsMarkedAsAbusive": {
"type": "danger",
"text": "Yes",
"origBValue": true,
"origSValue": "Yes",
"origNValue": null,
"origDValue": null
},
"hackedOrBeenHacked": {
"type": "info",
"text": "No",
"origBValue": false,
"origSValue": "No",
"origNValue": null,
"origDValue": null
},
"firewallFound": {
"type": "success",
"text": "Yes",
"origBValue": true,
"origSValue": "Yes",
"origNValue": null,
"origDValue": null
},
"markedAsRisk": {
"type": "info",
"text": "No",
"origBValue": false,
"origSValue": "No",
"origNValue": null,
"origDValue": null
},
"siteAdult": {
"type": "danger",
"text": "Yes",
"origBValue": true,
"origSValue": "Yes",
"origNValue": null,
"origDValue": null
},
"nastyTags": [],
"securityBadges": []
},
"sslInfo": [],
"firewall": "",
"blacklistStatus": [],
"externalScans": []
}
Rankings & Traffic
{
"trustedRank": "Low Rating",
"siteVisitors": "Low",
"googlebotvisit": "",
"googleindexed": "0",
"bingindexed": "0",
"yahooindexed": "0",
"yahoodir": "0",
"googlebacklinks": "0",
"yahoobacklinks": "0",
"validrank": "0",
"siteSpeed": "Very Fast",
"numPageViews": 1,
"webPresenceInfo": {
"socialMedia": {
"twitter": null,
"facebook": null,
"linkedin": null,
"instagram": null
},
"businessListings": [],
"newsReferences": []
},
"previousRank_count": 0
}
Domain Details
Domain Registrar
Domain's Name Servers 4 servers
| Domain | IP Address | Country | ISP | City | Postal Code |
|---|---|---|---|---|---|
| ns-1216.awsdns-24.org | 205.251.196.192 |
United States
|
Amazon.com, Inc. | Herndon | 20171 |
| ns-543.awsdns-03.net | 205.251.194.31 |
United States
|
Amazon.com | Chicago | 60666 |
| ns-124.awsdns-15.com | 205.251.192.124 |
United States
|
Amazon.com | Ashburn | 20149 |
| ns-1838.awsdns-37.co.uk | 205.251.199.46 |
United States
|
Amazon.com | Ashburn | 20149 |
| Domain | IP Address | Country | ISP | City | Postal Code |
|---|---|---|---|---|---|
|
ns-1216.awsdns-24.org
|
205.251.196.192 |
United States
|
Amazon.com, Inc.
|
Herndon | 20171 |
|
ns-543.awsdns-03.net
|
205.251.194.31 |
United States
|
Amazon.com
|
Chicago | 60666 |
|
ns-124.awsdns-15.com
|
205.251.192.124 |
United States
|
Amazon.com
|
Ashburn | 20149 |
|
ns-1838.awsdns-37.co.uk
|
205.251.199.46 |
United States
|
Amazon.com
|
Ashburn | 20149 |
{
"domainNameInfo": {
"hideSection": false,
"registrarName": "GoDaddy.com, LLC",
"registrarCountry": null,
"registrarEmail": "",
"registrarUrl": "",
"registrarWhoIs": "",
"age": "13 Years, 41 Days",
"createdDate": "2012-09-11T20:48:45.000000Z",
"expirationDate": null,
"lastModifiedDate": "2024-09-12T10:49:20.000000Z",
"owner": null,
"admin": null,
"technical": null,
"billing": null,
"whoisDataAge": "-1"
},
"registrar": {
"name": "GoDaddy.com, LLC",
"country": "",
"ip": "",
"whois": "whois.godaddy.com",
"home": ""
},
"contacts": {
"owner": {
"name": "",
"org": "",
"country": "",
"email": ""
},
"admin": {
"name": "",
"org": "",
"country": "",
"email": ""
},
"technical": {
"name": "",
"org": "",
"country": "",
"email": ""
}
},
"nameServers": [
{
"name": "ns-1216.awsdns-24.org",
"ip": "205.251.196.192",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"type": "NS",
"city": "Herndon",
"region": "",
"postcode": "20171",
"isp": "Amazon.com, Inc.",
"latitude": "38.9547",
"longitude": "-77.4043"
},
{
"name": "ns-543.awsdns-03.net",
"ip": "205.251.194.31",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"type": "NS",
"city": "Chicago",
"region": "",
"postcode": "60666",
"isp": "Amazon.com",
"latitude": "41.8781",
"longitude": "-87.6298"
},
{
"name": "ns-124.awsdns-15.com",
"ip": "205.251.192.124",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"type": "NS",
"city": "Ashburn",
"region": "",
"postcode": "20149",
"isp": "Amazon.com",
"latitude": "39.0438",
"longitude": "-77.4874"
},
{
"name": "ns-1838.awsdns-37.co.uk",
"ip": "205.251.199.46",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"type": "NS",
"city": "Ashburn",
"region": "",
"postcode": "20149",
"isp": "Amazon.com",
"latitude": "39.0438",
"longitude": "-77.4874"
}
],
"dates": {
"created": "2012-09-11T20:48:45.000000Z",
"expires": null,
"modified": "2024-09-12T10:49:20.000000Z"
}
}
Event Categories
Domain & Core
Web Archive History
Technical Events
Interactive Timeline
Domain Created
September 11, 2012
DomainFirst Archived
October 16, 2012
ArchiveDomain Modified
September 12, 2024
DomainFirst Analyzed
March 1, 2025
TechnicalLast Archived
March 29, 2025
ArchiveLast Updated
October 23, 2025
Technical| Logo | Technology | Description | Category | Popularity | First Seen |
|---|---|---|---|---|---|
|
|
Adobe Fonts
|
Adobe Fonts
|
Font scripts |
|
Unknown |
|
|
Apache HTTP Server
v2.4.58
|
Apache HTTP Server
|
Web Servers |
|
Unknown |
|
|
AWS Certificate Manager
|
AWS Certificate Manager
|
SSL/TLS certificate authorities |
|
Unknown |
|
DoubleClick Floodlight
|
Floodlight is feature of DoubleClick ads that allows advertisers to capture and report on the actions of users who visit their website after viewing or clicking on one of the advertiser's ads.
|
Analytics and Tracking |
|
Unknown |
|
Typekit
|
Typekit is the easiest way to use real fonts on the web. It's a subscription-based service for linking to high-quality Open Type fonts from some of the worlds best type foundries.
|
Widgets |
|
Unknown |
|
Ubuntu
|
Ubuntu is a free, Debian derived Linux-based operating system, available with both community and professional support.
|
Operating Systems and Servers |
|
Unknown |
|
jQuery CDN
|
The JQuery Amazon S3 Content Delivery Network
|
Content Delivery Network |
|
Unknown |
|
Amazon
|
This site is hosted on Amazon AWS EC2 Infrastructure.
|
Web Hosting Providers |
|
Unknown |
|
Bootstrap.js
v9
|
Twitter Bootstrap JS components.
|
JavaScript Libraries and Functions |
|
Unknown |
|
jQuery UI
v1.11.4
|
jQuery UI provides abstractions for low-level interaction and animation, advanced effects and high-level, themeable widgets, built on top of the jQuery JavaScript Library, that you can use to build highly interactive web applications.
|
JavaScript Libraries and Functions |
|
Unknown |
|
Google Hosted Libraries
|
Google Hosted Libraries is a globally available content distribution network for the most popular, open-source JavaScript libraries.
|
JavaScript Libraries and Functions |
|
Unknown |
|
Google Tag Manager
|
Tag management that lets you add and update website tags without changes to underlying website code.
|
Widgets |
|
Unknown |
|
Google Analytics
vGA4
|
Google Analytics offers a host of compelling features and benefits for everyone from senior executives and advertising and marketing professionals to site owners and content developers.
|
Analytics and Tracking |
|
Unknown |
|
PHP
v8.4.13
|
PHP is a widely-used general-purpose scripting language that is especially suited for Web development and can be embedded into HTML.
|
Frameworks |
|
Unknown |
|
jQuery
v3.3.1
|
JQuery is a fast, concise, JavaScript Library that simplifies how you traverse HTML documents, handle events, perform animations, and add Ajax interactions to your web pages. jQuery is designed to change the way that you write JavaScript.
|
JavaScript Libraries and Functions |
|
Unknown |
No Technologies Match Your Filter
Try adjusting your search terms or category filter
Hosting Provider
Network Infrastructure Protected
The information below shows the firewall infrastructure, not the origin server. This is actually a positive security indicator.
Shared Hosting Analysis 146 shared sites
Websites that have the same IP address as HARDANDALONE.COM
Australia
United States
United States
United States
United States
United States
Singapore
United States
United States
United States
United States
United States
United States
United States
United States
United Kingdom
United States
United States
United States
Canada
United States
United States
United States
United States
United States
United States
United States
United States
United States
Ireland
United States
United States
United States
United States
United States
United States
Belgium
United States
United States
Canada
Sweden
United States
United Kingdom
United States
United States
United States
United States
Canada
Canada
Germany
United Kingdom
United States
United Kingdom
United States
United Kingdom
United States
Canada
United States
United States
United States
United States
United States
United States
United States
Sweden
Canada
Canada
United States
United States
United States
United States
United States
Network Infrastructure
Performance Metrics
{
"hostingInfo": {
"hideSection": false,
"internetServiceProvider": "Amazon.com, Inc.",
"country": {
"code": "us",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"mostLikelyServerIp": "13.248.160.137",
"serverLocation": "United States",
"hostingProvider": "EasyRedir",
"asn": "16509",
"organizationName": "",
"serverOS": "",
"type": ""
},
"ip": "13.248.160.137",
"server": "EasyRedir",
"netOrg": "Amazon.com, Inc.",
"ipcountry": "us",
"firewall": "",
"registrar": "GoDaddy.com, LLC",
"registrarCountry": "",
"sharedIpSites": [
{
"domain": "harrispestmackay.com.au",
"rating": "1",
"country": {
"code": "AU",
"name": "Australia",
"flag": "\ud83c\udde6\ud83c\uddfa"
}
},
{
"domain": "branch.com",
"rating": "63",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "athenasoftware.net",
"rating": "93",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "portal.onewire.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "cortina-systems.com",
"rating": "98",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "janssen-deutschland.de",
"rating": "98",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "esilicon.com",
"rating": "98",
"country": {
"code": "SG",
"name": "Singapore",
"flag": "\ud83c\uddf8\ud83c\uddec"
}
},
{
"domain": "corvettesandmusclecars.com",
"rating": "99",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "pjsautoworld.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "rochesterregionalhealth.org",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "millikenchemical.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "tads.com",
"rating": "109",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "wella.co.uk",
"rating": "110",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "swobodapestcontrol.com",
"rating": "85",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "boohoo.fr",
"rating": "27",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "finance.debenhams.com",
"rating": "41",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "pullsdirect.com",
"rating": "42",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "airceldryers.com",
"rating": "46",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "foacommercial.com",
"rating": "50",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "prosperityws.com",
"rating": "50",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "hopkinsfirm.com",
"rating": "52",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "gerarddonderolaw.com",
"rating": "64",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "boohoo.co.uk",
"rating": "65",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "the3dgift.com",
"rating": "66",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "emerson-academy.org",
"rating": "70",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "vistacharteracademy.org",
"rating": "70",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "burton.co.uk",
"rating": "81",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "parkerhill.org",
"rating": "83",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "evolveclothing.com",
"rating": "83",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "campingworld.co.uk",
"rating": "84",
"country": {
"code": "IE",
"name": "Ireland",
"flag": "\ud83c\uddee\ud83c\uddea"
}
},
{
"domain": "absolutepest.com",
"rating": "84",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "winecoolerdirect.com",
"rating": "86",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "expresspipe.reece.com",
"rating": "86",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "grandriveracademy.org",
"rating": "86",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "quill-offers.com",
"rating": "91",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "patientwise.com",
"rating": "92",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "order.acuvue.it",
"rating": "92",
"country": {
"code": "BE",
"name": "Belgium",
"flag": "\ud83c\udde7\ud83c\uddea"
}
},
{
"domain": "aircompressorsdirect.org",
"rating": "93",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "beachbody.co.uk",
"rating": "94",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "donofriolawoffice.com",
"rating": "94",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "cliniqueveterinairelapepiniere.fr",
"rating": "94",
"country": {
"code": "SE",
"name": "Sweden",
"flag": "\ud83c\uddf8\ud83c\uddea"
}
},
{
"domain": "bodybeast.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "trutex.com",
"rating": "95",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "preventice.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "inphi.com",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "preventice.us",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "eternitydiamonds.us",
"rating": "95",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "preventicesolution.com",
"rating": "95",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "preventicetechnologies.com",
"rating": "95",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "wearencs.com",
"rating": "95",
"country": {
"code": "DE",
"name": "Germany",
"flag": "\ud83c\udde9\ud83c\uddea"
}
},
{
"domain": "bca.dk",
"rating": "95",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "slimin6.com",
"rating": "96",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "cvvillas.com",
"rating": "96",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "betterknowaballot.com",
"rating": "96",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "elizabeth-rose.com",
"rating": "97",
"country": {
"code": "UK",
"name": "United Kingdom",
"flag": "\ud83c\uddec\ud83c\udde7"
}
},
{
"domain": "preventice.cloud",
"rating": "97",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "preventicetest.com",
"rating": "97",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "cdx.bostonscientific.com",
"rating": "97",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "tiesto.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "Jnj.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "waylandgames.co.uk",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "dv8fashion.co.uk",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "bostonscientific.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "gimbal.com",
"rating": "100",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "thepethealthclub.co.uk",
"rating": "100",
"country": {
"code": "SE",
"name": "Sweden",
"flag": "\ud83c\uddf8\ud83c\uddea"
}
},
{
"domain": "mybodyguardian.com",
"rating": "100",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "meanwell-packaging.co.uk",
"rating": "100",
"country": {
"code": "CA",
"name": "Canada",
"flag": "\ud83c\udde8\ud83c\udde6"
}
},
{
"domain": "build.acl.com",
"rating": "105",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "dorma-kaba.se",
"rating": "96",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "datapointeurope.com",
"rating": "105",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "dierenkliniekhattemwapenveld.nl",
"rating": "107",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "northrocklanes.com",
"rating": "108",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
}
},
{
"domain": "mta-sts.mail.dorma-glas.de",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "vela.law",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "order.acuvue.dk",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "processingpros.shop",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "ustapr.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "franchise.leesfamousrecipe.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "sales-lentz.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "interactivedatascience.org",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "techastra.statefarm.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "7z9aij8x.edge.easyredir.net",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "surveyresults.sallinggroup.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "conseillers.investia.ca",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "revanceu.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "thescoutsshop.com.au",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "mclainmilitarylawyer.com.cdn.cloudflare.net",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "elektramusicgroup.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "clappmoroney.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "scottadamssays.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "cpanel.aerationsplusla.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "waterwisela.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "webdisk.aerationsplusla.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "webdisk.waterwisela.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "hello.digital22.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "video.digital22.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "botsy.app",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "absolutlaw.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "builders.co.ke",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "taylorprep.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "abogadosdeaccidenteslosangeles.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "hardlinepest.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "neumannlawyers.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "caplansjewelry.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "tastethefloorrecords.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "profound-france.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "tegnamarketingsolutions.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "bodyguardian.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "boostclinical.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "boostis.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "infosensor.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "prevent1ce.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "prevent1ce.info",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "prevent1ce.us",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventice.eu",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventice.info",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventice.nl",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventice.site",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventicegc.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventicemail.biz",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventicemail.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventices.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventiceservices.net",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventiceservices.org",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventicesolutions.biz",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventicesolutions.info",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventicetechnologies.info",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventicetest2.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "polymerics.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "thinkministry.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "feacegif.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "feacfslf.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "driverdirectphysicals.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "geneseeorthopedics.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "cliniqueveterinairedesoultz.fr",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "cliniqueveterinaireleshoublonnieres.fr",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "nic.fox",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "dormakaba.kz",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "bowlatparadise.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "sanfernandovalleylawyers.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "usfraudattorneys.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "nostalgicmotoringltd.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "preventice.biz",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "buyyoutubevideos.com",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "ryah.ca",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
},
{
"domain": "sjclassics.net",
"rating": null,
"country": {
"code": "XX",
"name": "Unknown",
"flag": "\ud83c\udf10"
}
}
]
}
No Historical Data Available
Website change history data is not available for this domain.
No Subdomains Discovered
No subdomains were found for this domain
This could indicate a simple site structure or restricted enumeration
IP Address History Timeline:
No Related Sites Found
No related websites were discovered for this domain
This indicates an isolated or independent web presence
Possibly Related Domains:
| Domain | Relationship | Status | Trust Score | Location | Action |
|---|---|---|---|---|---|
| Shared Server | Active | N/A | 🇦🇺 Australia | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇸🇬 Singapore | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇮🇪 Ireland | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇧🇪 Belgium | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇸🇪 Sweden | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇩🇪 Germany | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇬🇧 United Kingdom | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇸🇪 Sweden | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇨🇦 Canada | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🇺🇸 United States | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown | ||
| Shared Server | Active | N/A | 🌐 Unknown |
{
"subDomains": [],
"ipHistories": [
{
"id": "3865029",
"ip": "216.146.46.10",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"countryCode": "US",
"detectedDate": "",
"createTimestamp": "2016-09-01 15:35:30",
"period": "Sep 1, 2016",
"dateRange": "Sep 1, 2016",
"current": false
},
{
"id": "3865030",
"ip": "216.146.46.11",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"countryCode": "US",
"detectedDate": "",
"createTimestamp": "2016-09-01 15:35:33",
"period": "Sep 1, 2016",
"dateRange": "Sep 1, 2016",
"current": false
},
{
"id": "23937662",
"ip": "34.213.106.51",
"country": {
"code": "US",
"name": "United States",
"flag": "\ud83c\uddfa\ud83c\uddf8"
},
"countryCode": "US",
"detectedDate": "",
"createTimestamp": "2018-04-24 05:05:42",
"period": "Apr 24, 2018",
"dateRange": "Apr 24, 2018",
"current": false
}
],
"relatedSites": [],
"totalSubdomains": 0,
"totalIpChanges": 3,
"totalRelatedSites": 0
}
Need programmatic access to this domain analysis data?