staging.affinia.com is currently offline
CACHED DATASome of our analysis data below may be outdated as we're currently unable to scan the live site.
Highly Trusted
Why We Scored It 60/100
AI Website Analysis
As staging.affinia.com is actually a subdomain of affinia.com, this review is based on checking the parent website .staging.affinia.com has a average rating. Please be aware The data shown here represents the data for the parent website . As this website is a sub-domain, the actual creator/administrator of the website may be different to this data shown. If you have any queries about this sub-domain, we would suggest you contact the website
If you have any feedback on this website, please add a review to help others.
staging.affinia.com Preview
404 Not Found
Website Reputation
Domain Age
26 Years, 193 Days
Website Likely From
United States
Highly Trusted
Security Analysis
SSL Certificate
No
Expired 4 days ago
Firewall Protection
Not Protected
External Scans
Clean
Related to other Risky Websites
No
50% security standards met
Community Discussion
Join the conversation! Share your experience with staging.affinia.com and help others make informed decisions
FAQs
Common questions about staging.affinia.com website security analysis
Is staging.affinia.com safe to use?
Based on our comprehensive analysis, staging.affinia.com requires caution. Our security assessment gave it a trust score of 60/100.
Key factors analyzed:
- • SSL certificate validation and security
- • Domain age and registration details
- • Hosting location and infrastructure
- • Community reviews and reputation data
- • Blacklist checking across security databases
What do the trust scores mean?
Our trust scores range from 0-100 and indicate the overall safety and legitimacy of a website:
How accurate is this security analysis?
Our analysis combines multiple authoritative data sources and uses advanced algorithms to provide highly accurate assessments. However, no automated system is 100% perfect.
We recommend:
- • Using our analysis as one factor in your decision
- • Checking multiple review sources for important transactions
- • Trusting your instincts if something feels wrong
- • Being extra cautious with financial or personal information
What should I do if I encounter a scam website?
If you've encountered a scam website, take these immediate steps:
Immediate Actions:
- • Do not provide any personal or financial information
- • Close the website immediately
- • Run antivirus scan if you downloaded anything
- • Change passwords if you entered any credentials
Report the Scam:
- • Report to FTC at reportfraud.ftc.gov
- • Report to your local authorities
- • Submit a review on our platform to warn others
- • Share warnings with friends and family
Why does staging.affinia.com have this trust rating?
The trust rating for staging.affinia.com is based on multiple security and reputation factors:
Positive Factors:
- • No security warnings detected
Risk Factors:
- • No significant risks detected
staging.affinia.com is currently offline
CACHED DATASome of our analysis data below may be outdated as we're currently unable to scan the live site.
Highly Trusted
AI Website Analysis
As staging.affinia.com is actually a subdomain of affinia.com, this review is based on checking the parent website .staging.affinia.com has a average rating. Please be aware The data shown here represents the data for the parent website . As this website is a sub-domain, the actual creator/administrator of the website may be different to this data shown. If you have any queries about this sub-domain, we would suggest you contact the website
If you have any feedback on this website, please add a review to help others.
staging.affinia.com Preview
404 Not Found
Dashboard Controls:
Site Information
Key Statistics
Geographic Information
Business Contact Details
{ "domain": null, "title": "404 Not Found", "description": "", "age": "26 Years, 193 Days", "value": "", "country": "United States", "coordinates": "40.7368, -74.1734", "lastChecked": "2025-10-12T22:35:00.000000Z", "categories": null }
Risk Indicators
4Site Down
Low Traffic
Sign up to view
No Reviews
No Social Media Detected
Trust Indicators
0No trust indicators found
Site hasn't accumulated trust signals yet
SSL & Certificates
{ "securityInfo": { "hideSection": false, "sslValid": { "type": "danger", "text": "No", "origBValue": false, "origSValue": "No", "origNValue": null }, "sslName": "", "sslValidFrom": { "type": "primary", "text": "2025-10-13", "origSValue": "2025-10-13", "origBValue": null, "origNValue": null }, "sslValidFromDaysAgo": { "type": "warning", "text": "Only 4 days ago", "origNValue": -4, "origSValue": "Only 4 days ago", "origBValue": null }, "sslValidTo": { "type": "danger", "text": "2025-10-13", "origSValue": "2025-10-13", "origBValue": null, "origNValue": null }, "sslValidToDaysLeft": { "type": "danger", "text": "Expired 4 days ago", "origNValue": -4, "origSValue": "Expired 4 days ago", "origBValue": null }, "redirectsToHTTPS": [], "hasBadReviews": { "type": "info", "text": "No", "origBValue": false, "origSValue": "No", "origNValue": null, "origDValue": null }, "relatedToOtherNotTrustedSites": { "type": "info", "text": "No", "origBValue": false, "origSValue": "No", "origNValue": null, "origDValue": null }, "theirServerIpIsMarkedAsAbusive": { "type": "info", "text": "No", "origBValue": false, "origSValue": "No", "origNValue": null, "origDValue": null }, "hackedOrBeenHacked": { "type": "info", "text": "No", "origBValue": false, "origSValue": "No", "origNValue": null, "origDValue": null }, "firewallFound": { "type": "info", "text": "Not Protected", "origBValue": false, "origSValue": "Not Protected", "origNValue": null, "origDValue": null }, "markedAsRisk": { "type": "info", "text": "No", "origBValue": false, "origSValue": "No", "origNValue": null, "origDValue": null }, "siteAdult": { "type": "info", "text": "No", "origBValue": false, "origSValue": "No", "origNValue": null, "origDValue": null }, "nastyTags": [], "securityBadges": [] }, "sslInfo": { "hideSection": false, "subject": "", "startDate": "2025-10-13T00:00:00.000000Z", "expiryDate": "2025-10-13T00:00:00.000000Z", "valid": false }, "firewall": "", "blacklistStatus": [], "externalScans": [] }
Rankings & Traffic
Additional SEO Metrics
{ "trustedRank": "Low Rating", "siteVisitors": "Low", "googlebotvisit": "", "googleindexed": "0", "bingindexed": "0", "yahooindexed": "0", "yahoodir": "0", "validrank": "0", "siteSpeed": "Very Fast", "numPageViews": 3, "webPresenceInfo": { "socialMedia": { "twitter": null, "facebook": null, "linkedin": null, "instagram": null }, "businessListings": [], "newsReferences": [] } }
Domain Details
Domain Registrar
Domain WHOIS Information
Privacy Protection Notice
Most modern domain registrations use privacy protection services. Contact details may be redacted or replaced with privacy service information to protect registrant identity.
{ "domainNameInfo": { "hideSection": false, "registrarName": "CSC Corporate Domains, Inc.", "registrarCountry": null, "registrarEmail": "[email protected]", "registrarUrl": "", "registrarWhoIs": "", "age": "26 Years, 193 Days", "createdDate": "1999-04-06T00:00:00.000000Z", "expirationDate": "2026-04-06T00:00:00.000000Z", "lastModifiedDate": null, "owner": { "name": "", "organization": "Sonesta International Hotels Corporation", "email": "[email protected]", "phone": "8887802723", "fax": "", "street": "", "city": "", "state": "MA", "postalCode": "", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, "admin": { "name": "", "organization": "Sonesta International Hotels Corporation", "email": "[email protected]", "phone": "8887802723", "fax": "", "street": "", "city": "", "state": "MA", "postalCode": "", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, "technical": { "name": "", "organization": "", "email": "[email protected]", "phone": "8887802723", "fax": "", "street": "", "city": "", "state": "MA", "postalCode": "", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, "billing": null, "whoisDataAge": "5" }, "registrar": { "name": "CSC Corporate Domains, Inc.", "country": "", "ip": "", "whois": "", "home": "" }, "contacts": { "owner": { "name": "", "org": "Sonesta International Hotels Corporation", "country": "US", "email": "[email protected]" }, "admin": { "name": "", "org": "Sonesta International Hotels Corporation", "country": "US", "email": "[email protected]" }, "technical": { "name": "", "org": "", "country": "US", "email": "[email protected]" } }, "dates": { "created": "1999-04-06T00:00:00.000000Z", "expires": "2026-04-06T00:00:00.000000Z", "modified": null } }
Event Categories
Domain & Core
Technical Events
Interactive Timeline
Domain Created
April 6, 1999
DomainFirst Subdomain
April 6, 1999
TechnicalFirst Analyzed
April 28, 2024
TechnicalIP History First
October 9, 2025
TechnicalLast Updated
October 12, 2025
TechnicalDomain Expires
April 6, 2026
DomainHosting Provider
Server Information
Shared Hosting Analysis 139 shared sites
Websites that have the same IP address as STAGING.AFFINIA.COM
Network Infrastructure
Performance Metrics
{ "hostingInfo": { "hideSection": false, "internetServiceProvider": "OVH Hosting", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "mostLikelyServerIp": "13.248.160.137", "serverLocation": "United States", "hostingProvider": "EasyRedir", "asn": "16276", "organizationName": "", "serverOS": "", "type": "" }, "ip": "13.248.160.137", "server": "EasyRedir", "netOrg": "OVH Hosting", "ipcountry": "us", "firewall": "", "registrar": "CSC Corporate Domains, Inc.", "registrarCountry": "", "sharedIpSites": [ { "domain": "harrispestmackay.com.au", "rating": "1", "country": { "code": "AU", "name": "Australia", "flag": "\ud83c\udde6\ud83c\uddfa" } }, { "domain": "branch.com", "rating": "63", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "athenasoftware.net", "rating": "93", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "portal.onewire.com", "rating": "95", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "cortina-systems.com", "rating": "98", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "janssen-deutschland.de", "rating": "98", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "esilicon.com", "rating": "98", "country": { "code": "SG", "name": "Singapore", "flag": "\ud83c\uddf8\ud83c\uddec" } }, { "domain": "corvettesandmusclecars.com", "rating": "99", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "donofriolawoffice.com", "rating": "100", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "gimbal.com", "rating": "100", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "pjsautoworld.com", "rating": "100", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "rochesterregionalhealth.org", "rating": "100", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "millikenchemical.com", "rating": "100", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "preventice.com", "rating": "108", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "inphi.com", "rating": "108", "country": { "code": "CA", "name": "Canada", "flag": "\ud83c\udde8\ud83c\udde6" } }, { "domain": "tads.com", "rating": "109", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "wella.co.uk", "rating": "110", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "swobodapestcontrol.com", "rating": "85", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "boohoo.fr", "rating": "27", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "finance.debenhams.com", "rating": "41", "country": { "code": "UK", "name": "United Kingdom", "flag": "\ud83c\uddec\ud83c\udde7" } }, { "domain": "pullsdirect.com", "rating": "42", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "airceldryers.com", "rating": "46", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "foacommercial.com", "rating": "50", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "yalumba.com", "rating": "54", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "cliniqueveterinairelapepiniere.fr", "rating": "57", "country": { "code": "CA", "name": "Canada", "flag": "\ud83c\udde8\ud83c\udde6" } }, { "domain": "boohoo.co.uk", "rating": "65", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "emerson-academy.org", "rating": "70", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "vistacharteracademy.org", "rating": "70", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "burton.co.uk", "rating": "81", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "evolveclothing.com", "rating": "83", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "campingworld.co.uk", "rating": "84", "country": { "code": "IE", "name": "Ireland", "flag": "\ud83c\uddee\ud83c\uddea" } }, { "domain": "absolutepest.com", "rating": "84", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "winecoolerdirect.com", "rating": "86", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "grandriveracademy.org", "rating": "86", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "quill-offers.com", "rating": "91", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "patientwise.com", "rating": "92", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "bodybeast.com", "rating": "95", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "trutex.com", "rating": "95", "country": { "code": "UK", "name": "United Kingdom", "flag": "\ud83c\uddec\ud83c\udde7" } }, { "domain": "preventice.cloud", "rating": "95", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "wearencs.com", "rating": "95", "country": { "code": "DE", "name": "Germany", "flag": "\ud83c\udde9\ud83c\uddea" } }, { "domain": "bca.dk", "rating": "95", "country": { "code": "UK", "name": "United Kingdom", "flag": "\ud83c\uddec\ud83c\udde7" } }, { "domain": "cvvillas.com", "rating": "96", "country": { "code": "UK", "name": "United Kingdom", "flag": "\ud83c\uddec\ud83c\udde7" } }, { "domain": "order.acuvue.it", "rating": "96", "country": { "code": "BE", "name": "Belgium", "flag": "\ud83c\udde7\ud83c\uddea" } }, { "domain": "elizabeth-rose.com", "rating": "97", "country": { "code": "UK", "name": "United Kingdom", "flag": "\ud83c\uddec\ud83c\udde7" } }, { "domain": "cdx.bostonscientific.com", "rating": "97", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "Jnj.com", "rating": "100", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "waylandgames.co.uk", "rating": "100", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "thepethealthclub.co.uk", "rating": "100", "country": { "code": "SE", "name": "Sweden", "flag": "\ud83c\uddf8\ud83c\uddea" } }, { "domain": "meanwell-packaging.co.uk", "rating": "100", "country": { "code": "CA", "name": "Canada", "flag": "\ud83c\udde8\ud83c\udde6" } }, { "domain": "build.acl.com", "rating": "105", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "parkerhill.org", "rating": "110", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "dorma-kaba.se", "rating": "96", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "datapointeurope.com", "rating": "105", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "dierenkliniekhattemwapenveld.nl", "rating": "107", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "northrocklanes.com", "rating": "108", "country": { "code": "US", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" } }, { "domain": "mta-sts.mail.dorma-glas.de", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "vela.law", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "order.acuvue.dk", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "processingpros.shop", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "ustapr.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "franchise.leesfamousrecipe.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "sales-lentz.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "interactivedatascience.org", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "techastra.statefarm.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "7z9aij8x.edge.easyredir.net", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "surveyresults.sallinggroup.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "conseillers.investia.ca", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "betterknowaballot.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "revanceu.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "thescoutsshop.com.au", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "mclainmilitarylawyer.com.cdn.cloudflare.net", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "elektramusicgroup.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "gerarddonderolaw.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "clappmoroney.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "scottadamssays.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "cpanel.aerationsplusla.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "waterwisela.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "webdisk.aerationsplusla.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "webdisk.waterwisela.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "hello.digital22.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "video.digital22.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "prosperityws.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "botsy.app", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "absolutlaw.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "builders.co.ke", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "taylorprep.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "eternitydiamonds.us", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "abogadosdeaccidenteslosangeles.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "hardlinepest.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "neumannlawyers.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "caplansjewelry.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "tastethefloorrecords.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "profound-france.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "tegnamarketingsolutions.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "bodyguardian.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "boostclinical.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "boostis.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "infosensor.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "mybodyguardian.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "prevent1ce.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "prevent1ce.info", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "prevent1ce.us", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventice.eu", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventice.info", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventice.nl", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventice.site", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicegc.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicemail.biz", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicemail.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventices.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventiceservices.net", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventiceservices.org", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicesolution.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicesolutions.biz", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicesolutions.info", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicetechnologies.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicetechnologies.info", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicetest.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventicetest2.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "polymerics.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "thinkministry.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "feacegif.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "feacfslf.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "driverdirectphysicals.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "geneseeorthopedics.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "the3dgift.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "cliniqueveterinairedesoultz.fr", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "cliniqueveterinaireleshoublonnieres.fr", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "dormakaba.kz", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "bowlatparadise.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventice.us", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "sanfernandovalleylawyers.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "usfraudattorneys.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "nostalgicmotoringltd.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "preventice.biz", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "buyyoutubevideos.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "ryah.ca", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "hopkinsfirm.com", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } }, { "domain": "sjclassics.net", "rating": null, "country": { "code": "XX", "name": "Unknown", "flag": "\ud83c\udf10" } } ] }
No Historical Data Available
Website change history data is not available for this domain.
Discovered Subdomains:
Subdomain | Country | Trust Rating | IP Address |
---|---|---|---|
accounts.affinia.com
Created: Apr 6, 1999
|
United States
|
Medium Risk | 142.44.217.176 |
apps.affinia.com
Created: Apr 6, 1999
|
United States
|
Low Risk Site | 142.44.217.176 |
autodiscover.staging.affinia.com
Created: Apr 6, 1999
|
United States
|
Low Risk Site | 142.44.217.176 |
cpanel.staging.affinia.com
Created: Apr 6, 1999
|
United States
|
Low Risk Site | 142.44.217.176 |
exch.affinia.com
Created: Apr 6, 1999
|
United States
|
Low Risk Site | 142.44.217.176 |
mail.staging.affinia.com
Created: Apr 6, 1999
|
United States
|
Low Risk Site | 142.44.217.176 |
my.affinia.com
Created: Apr 6, 1999
|
United States
|
Low Risk Site | 142.44.217.176 |
new.affinia.com
Created: Apr 6, 1999
|
United States
|
Low Risk Site | 142.44.217.176 |
ppn.affinia.com
Created: Apr 6, 1999
|
United States
|
Low Risk Site | 142.44.217.176 |
shop.affinia.com
Created: Apr 6, 1999
|
United States
|
Low Risk Site | 142.44.217.176 |
staging.affinia.com
Created: Apr 6, 1999
|
United States
|
Low Risk Site | 142.44.217.176 |
webdisk.staging.affinia.com
Created: Apr 6, 1999
|
United States
|
Medium Risk | 142.44.217.176 |
webmail.affinia.com
Created: Apr 6, 1999
|
United States
|
Low Risk Site | 142.44.217.176 |
IP Address History Timeline:
No Related Sites Found
No related websites were discovered for this domain
This indicates an isolated or independent web presence
Possibly Related Domains:
{ "subDomains": [ { "subdomain": "accounts.affinia.com", "name": "accounts.affinia.com", "ip": "142.44.217.176", "active": true, "status": "active", "rating": "60", "trustScore": "60", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "ipcountry": "us", "likelyCountry": "us", "discovered": "1999-04-06", "lastChecked": "1999-04-06", "title": "", "description": "" }, { "subdomain": "apps.affinia.com", "name": "apps.affinia.com", "ip": "142.44.217.176", "active": true, "status": "active", "rating": "95", "trustScore": "95", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "ipcountry": "us", "likelyCountry": "us", "discovered": "1999-04-06", "lastChecked": "1999-04-06", "title": "", "description": "" }, { "subdomain": "autodiscover.staging.affinia.com", "name": "autodiscover.staging.affinia.com", "ip": "142.44.217.176", "active": true, "status": "active", "rating": "97", "trustScore": "97", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "ipcountry": "us", "likelyCountry": "us", "discovered": "1999-04-06", "lastChecked": "1999-04-06", "title": "", "description": "" }, { "subdomain": "cpanel.staging.affinia.com", "name": "cpanel.staging.affinia.com", "ip": "142.44.217.176", "active": true, "status": "active", "rating": "95", "trustScore": "95", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "ipcountry": "us", "likelyCountry": "us", "discovered": "1999-04-06", "lastChecked": "1999-04-06", "title": "", "description": "" }, { "subdomain": "exch.affinia.com", "name": "exch.affinia.com", "ip": "142.44.217.176", "active": true, "status": "active", "rating": "95", "trustScore": "95", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "ipcountry": "us", "likelyCountry": "us", "discovered": "1999-04-06", "lastChecked": "1999-04-06", "title": "", "description": "" }, { "subdomain": "mail.staging.affinia.com", "name": "mail.staging.affinia.com", "ip": "142.44.217.176", "active": true, "status": "active", "rating": "95", "trustScore": "95", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "ipcountry": "us", "likelyCountry": "us", "discovered": "1999-04-06", "lastChecked": "1999-04-06", "title": "", "description": "" }, { "subdomain": "my.affinia.com", "name": "my.affinia.com", "ip": "142.44.217.176", "active": true, "status": "active", "rating": "97", "trustScore": "97", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "ipcountry": "us", "likelyCountry": "us", "discovered": "1999-04-06", "lastChecked": "1999-04-06", "title": "", "description": "" }, { "subdomain": "new.affinia.com", "name": "new.affinia.com", "ip": "142.44.217.176", "active": true, "status": "active", "rating": "96", "trustScore": "96", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "ipcountry": "us", "likelyCountry": "us", "discovered": "1999-04-06", "lastChecked": "1999-04-06", "title": "", "description": "" }, { "subdomain": "ppn.affinia.com", "name": "ppn.affinia.com", "ip": "142.44.217.176", "active": true, "status": "active", "rating": "95", "trustScore": "95", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "ipcountry": "us", "likelyCountry": "us", "discovered": "1999-04-06", "lastChecked": "1999-04-06", "title": "", "description": "" }, { "subdomain": "shop.affinia.com", "name": "shop.affinia.com", "ip": "142.44.217.176", "active": true, "status": "active", "rating": "95", "trustScore": "95", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "ipcountry": "us", "likelyCountry": "us", "discovered": "1999-04-06", "lastChecked": "1999-04-06", "title": "", "description": "" }, { "subdomain": "staging.affinia.com", "name": "staging.affinia.com", "ip": "142.44.217.176", "active": true, "status": "active", "rating": "97", "trustScore": "97", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "ipcountry": "us", "likelyCountry": "us", "discovered": "1999-04-06", "lastChecked": "1999-04-06", "title": "", "description": "" }, { "subdomain": "webdisk.staging.affinia.com", "name": "webdisk.staging.affinia.com", "ip": "142.44.217.176", "active": true, "status": "active", "rating": "60", "trustScore": "60", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "ipcountry": "us", "likelyCountry": "us", "discovered": "1999-04-06", "lastChecked": "1999-04-06", "title": "", "description": "" }, { "subdomain": "webmail.affinia.com", "name": "webmail.affinia.com", "ip": "142.44.217.176", "active": true, "status": "active", "rating": "95", "trustScore": "95", "country": { "code": "us", "name": "United States", "flag": "\ud83c\uddfa\ud83c\uddf8" }, "ipcountry": "us", "likelyCountry": "us", "discovered": "1999-04-06", "lastChecked": "1999-04-06", "title": "", "description": "" } ], "ipHistories": [ { "id": "39202422", "ip": "142.44.217.176", "country": { "code": "Ar", "name": "Argentina", "flag": "\ud83c\udde6\ud83c\uddf7" }, "countryCode": "Ar", "detectedDate": "2025-10-09 12:34:55", "createTimestamp": "2025-10-09 12:34:55", "period": "Oct 9, 2025", "dateRange": "Oct 9, 2025", "current": false }, { "id": "39249330", "ip": "13.248.160.137", "country": { "code": "Ar", "name": "Argentina", "flag": "\ud83c\udde6\ud83c\uddf7" }, "countryCode": "Ar", "detectedDate": "2025-10-12 22:17:05", "createTimestamp": "2025-10-12 22:17:05", "period": "Oct 12, 2025", "dateRange": "Oct 12, 2025", "current": false } ], "relatedSites": [], "totalSubdomains": 13, "totalIpChanges": 2, "totalRelatedSites": 0 }
Need programmatic access to this domain analysis data?